{"title":"Vandperle","description":"","products":[{"product_id":"honey-bee-pearl-stud-earrings-elegant-gold-tone-jewelry-for-women","title":"Honey Bee Pearl Stud Earrings – Elegant Gold-Tone Jewelry for Women","description":"\u003cp\u003eAdd a touch of elegance and charm with these \u003cstrong\u003ehoney bee pearl stud earrings\u003c\/strong\u003e. Designed with sparkling wings and a glossy pearl body, these earrings bring together \u003cstrong\u003enature-inspired beauty and timeless style\u003c\/strong\u003e. Perfect for weddings, parties, birthdays, or everyday sophistication.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eCharming Design:\u003c\/strong\u003e Gold-tone honey bee with pearl body and crystal wings.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eElegant Look:\u003c\/strong\u003e Small and delicate, perfect for adding subtle sparkle.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eComfortable Wear:\u003c\/strong\u003e Lightweight stud style for all-day use.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eVersatile:\u003c\/strong\u003e Ideal for weddings, parties, or everyday outfits.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eGift Ready:\u003c\/strong\u003e A thoughtful present for birthdays, anniversaries, or special occasions\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003eMaterials \u0026amp; Size\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003eMetal:\u003c\/strong\u003e Gold-tone alloy.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eStones:\u003c\/strong\u003e Clear cubic zirconia accents.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eBody:\u003c\/strong\u003e Polished pearl bead.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eClosure:\u003c\/strong\u003e Stud push-back design.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch3\u003eCare Instructions\u003c\/h3\u003e\n\u003cul\u003e\n\u003cli\u003eAvoid contact with water, perfumes, and lotions.\u003c\/li\u003e\n\u003cli\u003eRemove before swimming, showering, or exercising.\u003c\/li\u003e\n\u003cli\u003eWipe gently with a soft cloth after wear.\u003c\/li\u003e\n\u003cli\u003eStore in a dry jewelry pouch or box.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv style=\"background: #f9f9f9; border: 1px solid #eee; border-radius: 8px; padding: 12px; margin: 16px 0;\"\u003e\n\u003cstrong\u003eStyle Tip:\u003c\/strong\u003e\n\u003cp style=\"margin: 8px 0 0;\"\u003ePair these \u003cem\u003eHoney Bee Pearl Earrings\u003c\/em\u003e with a pearl necklace or gold bracelet for a chic and coordinated look.\u003c\/p\u003e\n\u003c\/div\u003e\n\u003cp style=\"margin-top: 14px;\"\u003eShine with elegance and charm with these \u003cstrong\u003eHoney Bee Pearl Stud Earrings\u003c\/strong\u003e—a perfect balance of playful design and timeless beauty.\u003c\/p\u003e","brand":"Alma Smykker","offers":[{"title":"Default","offer_id":56864608878967,"sku":"Fq1765716103509526610","price":22.34,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Honey_Bee_Pearl_Stud_Earrings__Elegant_Gold-Tone_Jewelry_for_Women_0.jpg?v=1773329809"},{"product_id":"a-womens-fashion-bracelet-vintage-bohemian-style-thin-elastic-bracelet-with-teal-miyuki-beads-a-good-luck-bracelet-minimalist-womens-bracelet-womens-gift","title":"Coastal Pearl Seed Bead Bracelet","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Coastal Pearl Seed Bead Bracelet—a seaside-inspired piece that combines tiny seed beads with pearl-toned accents to capture the quiet shimmer of the shore. Designed for everyday elegance, it adds a touch of beachy sophistication to any outfit, from casual denim to breezy summer dresses.\u003c\/p\u003e \u003cp\u003eWhat makes this bracelet special is the delicate interplay between texture and luster. The micro seed beads create a soft, tactile surface that catches the light with every move, while pearl-toned beads provide a timeless, coastal glow. The result is a bracelet that feels both contemporary and timeless, pairing effortlessly with other jewelry or standing out on its own as a quiet statement.\u003c\/p\u003e \u003ch2\u003eWhy you’ll love it\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eCoastal versatility:\u003c\/strong\u003e a perfect accent for beach weddings, seaside vacations, or everyday wear that needs that hint of ocean-inspired charm.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle shimmer:\u003c\/strong\u003e the micro beadwork refracts light for a gentle glow without overpowering your look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight and comfortable:\u003c\/strong\u003e crafted for all-day wear so you can enjoy its beauty from morning meetings to sunset strolls.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDesigned for layering:\u003c\/strong\u003e pairs beautifully with other bracelets or bangles, letting you create your own coastal stack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance care:\u003c\/strong\u003e simple to clean—wipe with a soft cloth and keep away from harsh chemicals to preserve the pearl-like finish.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho is this for?\u003c\/h2\u003e\n\u003cp\u003eIdeal for anyone who loves the sea-inspired aesthetic—whether you’re building a coastal-inspired jewelry collection, searching for a thoughtful gift for a beach lover, or seeking a versatile piece that complements both casual and dressier ensembles.\u003c\/p\u003e \u003ch2\u003eCare and longevity\u003c\/h2\u003e\n\u003cp\u003eTo keep the Coastal Pearl Seed Bead Bracelet looking its best, wipe it gently after wear and store it in a cool, dry place away from excessive moisture. Avoid exposure to harsh chemicals, lotions, or saltwater for prolonged periods to maintain the delicate pearl-toned accents and the beadwork’s integrity.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936602567031,"sku":"SKU_1772744112757_269","price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/39c59bf8fb1a4ebd9507b05b61001bd5-goods.jpg?v=1774538174"},{"product_id":"brincos-de-perola-de-agua-doce-verdadeira-com-diamante-brincos-de-perola-com-zirconia-cubica-brincos-de-casamento-brincos-de-perola-para-noivas-presentes-para-madrinhas","title":"Pearl Drop Trio Sparkle Studs","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Drop Trio Sparkle Studs\u003c\/strong\u003e bring timeless elegance into everyday life with a modern twist. These pearl earrings are designed to shine under daylight and glow at night, making them a versatile addition to any jewelry collection.\u003c\/p\u003e \u003cp\u003eThree luminous pearl drops are styled in a graceful trio on a compact stud, creating subtle movement and depth with every turn of your head. A touch of sparkle—delicate crystal accents—enhances the pearls’ natural radiance without overpowering their classic beauty. The result is a pair of pearl drop earrings that read refined and approachable, whether you’re pairing them with a blazer for the office or a dress for a special occasion.\u003c\/p\u003e \u003cp\u003eThese earrings are ideal for anyone who loves understated luxury and easy styling. They work beautifully with:\u003c\/p\u003e \u003cul\u003e \u003cli\u003eEveryday work outfits, bringing polish to shirts, knits, and blazers\u003c\/li\u003e \u003cli\u003eWedding party looks—bridesmaids or guests—without stealing the spotlight from the dress\u003c\/li\u003e \u003cli\u003eSpecial occasions, date nights, and social events where a little shimmer goes a long way\u003c\/li\u003e \u003cli\u003eGift-giving moments for birthdays, anniversaries, or holidays\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhy choose the Pearl Drop Trio Sparkle Studs over other pearl earrings? The triple drop design adds dimensionality and a touch of movement that single-drop styles can’t match, while the built-in sparkle keeps the look contemporary and camera-ready. The compact stud back keeps the pair secure and comfortable for all-day wear, so you can enjoy the elegant detail from morning meetings to evening outings.\u003c\/p\u003e \u003cp\u003eCare is simple: wipe with a soft cloth after wear, keep them away from harsh chemicals, and store in a protective pouch to preserve their luster. When you want a reliable, versatile piece that elevates every outfit, these Pearl Drop Trio Sparkle Studs are a thoughtful choice.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Gold","offer_id":56936602632567,"sku":"SKU_1772806730601_663","price":25.79,"currency_code":"EUR","in_stock":true},{"title":"Silver","offer_id":56936602665335,"sku":"SKU_1772806730601_664","price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/2_ee45f562-4ace-44e4-bb39-68e197935499.jpg?v=1774538174"},{"product_id":"elegant-faux-pearl-choker-bohemian-elegant-single-strand-faux-pearl-choker-necklace-for-women-clavicle-chain-imitation-pearls-perfect-for-parties-gatherings-and-gifts-versatile-accessory","title":"Bohemian Elegant Pearl Choker","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the \u003cstrong\u003eBohemian Elegant Pearl Choker\u003c\/strong\u003e—a necklace that fuses carefree boho charm with timeless pearl refinement. This piece is designed to elevate your everyday style and shine at special moments, from sunlit brunches to intimate evenings. If you love accessories that feel effortless yet thoughtfully crafted, this choker is for you.\u003c\/p\u003e \u003cp\u003eWhy it stands out:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eBohemian-inspired elegance\u003c\/strong\u003e meets classic pearl allure. The strand borrows the laid‑back, artisanal vibe of boho jewelry while delivering a polished focal point for any look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e that adapts to your outfit—wear it solo for a delicate, refined glow or pair it with other necklaces to create a layered boho cascade.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday wear with a touch of glamour\u003c\/strong\u003e—its graceful drape sits at the collarbone, making it perfect over a summer sundress, under a blazer, or with a simple tee that wants a little sparkle.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance care\u003c\/strong\u003e designed for real-life wear: a gentle wipe keeps the shine, and avoiding prolonged moisture helps preserve the luster over time.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIdeal for gifting and occasions\u003c\/strong\u003e—a thoughtful choice for bridesmaids, wedding guests, festival-goers, or anyone who loves a chic, carefree aesthetic.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho this is for: fashion-forward individuals who yearn for a piece that feels both romantic and modern; for those building a boho‑inspired jewelry collection; for anyone seeking a necklace that transitions seamlessly from day to night without overpowering the outfit.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eHow to wear it\u003c\/strong\u003e: pair with a flowing maxi and sandals for a sun-kissed festival vibe, drape over a crisp white blouse to elevate a minimalist work look, or stack with a longer chain to craft a trendy, layered silhouette. Its timeless pearl motif makes it an instant upgrade for wedding guest ensembles or romantic date nights, while its bohemian twist keeps it from feeling too formal.\u003c\/p\u003e \u003cp\u003eCare tips to keep the luster lasting: store in a cool, dry place away from humidity; wipe with a soft, lint-free cloth after wear; and avoid contact with lotions or perfumes that can dull the finish. When you want a touch of elegance with effortless charm, the Bohemian Elegant Pearl Choker is ready to accompany you through everyday adventures and unforgettable moments alike.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936602730871,"sku":"SKU_1772674063586_209","price":31.81,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/6e0efc9c7f1b9e05ddc76d89e3b9d03b.jpg?v=1774538174"},{"product_id":"colar-toi-et-moi-colar-de-perolas-e-diamantes-colar-com-pingente-de-lagrima-colar-com-pingente-de-perola-colar-de-noiva-joias-para-madrinhas","title":"Pearl Teardrop Duo Charm Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eMeet the Pearl Teardrop Duo Charm Necklace—a refined update to the classic pearl silhouette. This piece pairs two teardrop-shaped pearls with a slim, elegant chain, creating a look that feels timeless yet refreshingly modern.\u003c\/p\u003e \u003cp\u003eThe twin teardrop charms catch the light with a soft luster, delivering subtle movement and quiet drama as you move. It’s the kind of necklace that transitions effortlessly from a busy workday to an evening out, adding a hint of sophistication without shouting for attention.\u003c\/p\u003e \u003ch3\u003eWhat makes this pearl necklace uniquely appealing\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDual teardrop pearls:\u003c\/strong\u003e A distinctive focal point that sets this piece apart from a single-pendant pearl necklace, offering a contemporary twist on a timeless motif.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDelicate, versatile chain:\u003c\/strong\u003e A slender loop that layers beautifully with other necklaces or stands on its own as a polished everyday staple.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless elegance for any occasion:\u003c\/strong\u003e From office chic to wedding guest glamour, this necklace adapts to your style with quiet confidence.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift potential:\u003c\/strong\u003e A meaningful choice for birthdays, anniversaries, bridesmaids, or a treat for someone who loves classic meets contemporary jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho it’s ideal for\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePeople who appreciate the timeless appeal of pearls with a modern, two-pearl twist.\u003c\/li\u003e \u003cli\u003eIndividuals seeking a versatile necklace that works with tailored workwear, casual denim, or a little black dress.\u003c\/li\u003e \u003cli\u003eGift givers looking for a refined piece that communicates understated luxury and thoughtful design.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eUse cases and styling ideas\u003c\/h3\u003e\n\u003cp\u003ePair this necklace with a crisp blouse for a polished professional look, or wear it with a V-neck dress to draw attention to the neckline during special occasions. Layer it with a delicate longer chain for a curated, editorial vibe, or keep it simple for a minimalist daytime ensemble. Its timeless charm makes it a reliable go-to piece that complements pearls of other shapes or finishes.\u003c\/p\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTreat the pearls and chain with the same care you give your finest jewelry. Wipe gently with a soft cloth after wear to remove oils, store in a soft pouch or jewelry box to prevent scratching, and avoid contact with harsh chemicals or chlorine. With proper care, the Pearl Teardrop Duo Charm Necklace remains a graceful staple in your jewelry collection.\u003c\/p\u003e \u003cp\u003eDiscover how the Pearl Teardrop Duo Charm Necklace can elevate your everyday style or become a meaningful gift that celebrates timeless beauty with a modern edge. A refined choice for anyone who values a necklace that embodies both heritage and contemporary charm.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Silver","offer_id":56936602763639,"sku":"SKU_1772806633866_418","price":38.7,"currency_code":"EUR","in_stock":true},{"title":"Gold","offer_id":56936602796407,"sku":"SKU_1772806633866_199","price":38.7,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Flat_lay_photo_202604281741.jpg?v=1777394471"},{"product_id":"european-and-american-fashion-large-and-rings-for-women-korean-and-japanese-niche-design-high-end-plain-band-rings-gift-for-girlfriend-index-finger-ring","title":"Duo Pearl Adjustable Statement Ring","description":"\u003cdiv\u003e\n\u003cp\u003eStep into the spotlight with the Duo Pearl Adjustable Statement Ring — where classic pearl beauty meets a bold, modern silhouette. Two lustrous pearls anchor a sleek, sculpted band, creating a focal point that shines from every angle.\u003c\/p\u003e \u003cp\u003eThe ring’s adjustable design means a perfect, comfortable fit across a range of finger sizes, letting you switch styles without swapping rings. This is jewelry that adapts to you—whether you’re dressing for a professional look, a night out, or a weekend brunch with friends.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDual pearl centerpiece:\u003c\/strong\u003e A distinctive, balanced accent that elevates any outfit with a touch of timeless elegance.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAdjustable comfort fit:\u003c\/strong\u003e Flexible sizing to accommodate different fingers and mood—no guessing about ring size needed.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eStatement-ready design:\u003c\/strong\u003e Adds architectural interest to both minimalist and more ornate ensembles.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e Complements other pearl pieces or anchors a contemporary stack with ease.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift option:\u003c\/strong\u003e A memorable choice for birthdays, anniversaries, or a special milestone.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for pearl lovers who crave a fresh, fashion-forward twist, this ring pairs beautifully with a pencil skirt and blouse for the office, or with a little black dress for evening events. Its two-pearl focal point ensures you stand out without shouting — a refined statement that works with your existing jewelry collection.\u003c\/p\u003e \u003cp\u003eCare tip: to preserve the pearls’ natural luster, wipe with a soft cloth after wear and avoid contact with harsh chemicals. Store separately to protect the band’s finish and the pearls’ glow.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936602599799,"sku":"SKU_1772744002002_460","price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_07a89696-14c6-4418-91f7-f634d8527c03.png?v=1774538175"},{"product_id":"three-pieces-of-womens-fashion-choker-necklaces-featuring-shell-and-starfish-pendants-easy-and-youthful-design-with-faux-pearl-inlays-golden-beads-for-layering-made-of-glass-seed-beads-perfect-for-summer-beach-vacations","title":"Seaside Starfish Beaded Layer Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eCapture the essence of sun, sea, and effortless style with the Seaside Starfish Beaded Layer Necklace. This multi‑strand piece is designed for fans of coastal chic who want a graceful, eye‑catching accessory that elevates any outfit—from a breezy sundress to a crisp blazer for a seaside‑inspired look.\u003c\/p\u003e \u003cp\u003eThe star of the design is a thoughtfully crafted starfish charm, anchored by delicate beaded strands that layer in a soft, ocean‑hinted silhouette. It’s a neckline‑flattering necklace that adds depth without overwhelming the rest of your look, making it a versatile addition to your jewelry collection.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eLayered, ocean‑inspired design:\u003c\/strong\u003e two dainty bead strands crowned with a charming starfish pendant that serves as a focal point.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile wearing length:\u003c\/strong\u003e designed to sit gracefully at the collarbone and complement necklines from V‑necks to boat necks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday elegance:\u003c\/strong\u003e lightweight construction with durable fittings for comfortable daily wear and easy styling.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePerfect coastal gift:\u003c\/strong\u003e an thoughtful choice for ocean lovers, bridesmaids, or anyone who adores beachy, nautical vibes.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eStyle, use cases, and practical notes\u003c\/h3\u003e\n\u003cp\u003ePair this Seaside Starfish Beaded Layer Necklace with white linen, denim, or soft pastels to instantly evoke a seaside getaway. It transitions beautifully from day to night—think beach brunches, vacation photos, or a sunset stroll along the boardwalk. Layer it with a longer pendant or a simple chain for a personalized, on‑trend look that still feels effortless.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: to preserve its soft shimmer, remove it before swimming or showering, wipe with a gentle cloth after wear, and store separately to avoid tangling. Regular, light cleaning helps maintain the beads’ luster and the starfish charm’s charm.\u003c\/p\u003e \u003cp\u003eWhether you’re shopping for a gift, refreshing your vacation wardrobe, or looking for a distinctive piece that nods to nautical charm, the Seaside Starfish Beaded Layer Necklace offers a balanced blend of romance, versatility, and coastal character. It’s not just jewelry—it’s a reminder of sunlit days by the shore, captured in a necklace you’ll reach for again and again.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936603353463,"sku":"SKU_1772641752105_315","price":36.98,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/adacd768b8944d5298fd888044145683-goods.png?v=1774538182"},{"product_id":"brincos-de-perolas-e-diamantes-brincos-de-perolas-de-agua-doce-brincos-de-cristal-para-noivas-brincos-de-diamantes-com-folha-de-ouro-brincos-de-casamento-presente-para-madrinhas","title":"Pearl Leaf Cluster Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Leaf Cluster Drop Earrings\u003c\/strong\u003e fuse the timeless shimmer of pearls with a graceful, nature-inspired leaf silhouette. Designed to feel both classic and contemporary, these earrings offer a refined statement that transitions effortlessly from day to night.\u003c\/p\u003e \u003cp\u003eIn a refined drop style, a cluster of luminous pearl beads comes together to form a delicate leaf shape. The result is an accessory with subtle texture and movement, catching light with every turn of your head and drawing attention to your neckline without overwhelming your overall look.\u003c\/p\u003e \u003ch3\u003eWhy this design stands apart\u003c\/h3\u003e\n\u003cp\u003eRather than a flat pearl drop, the leaf-cluster arrangement adds depth and dimension, giving your jewelry a handcrafted, botanical feel. The combination of pearls and a leaf motif creates a versatile piece that pairs beautifully with both minimalist outfits and more ornate ensembles.\u003c\/p\u003e \u003ch3\u003ePerfect for any occasion\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eWedding guests or bridesmaids seeking a touch of elegance with a modern twist\u003c\/li\u003e \u003cli\u003eGlamourous date nights, cocktail parties, or gala events\u003c\/li\u003e \u003cli\u003eProfessional settings where a polished, timeless look is desired\u003c\/li\u003e \u003cli\u003eGift for someone who loves nature-inspired jewelry and pearl elegance\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003e styling tips\u003c\/h3\u003e\n\u003cp\u003ePair with a sleek black dress to let the pearl luster shine, or combine with a soft pastel blouse for a daytime event. The understated drop length adds movement without overpowering your hair or makeup, making it easy to wear with updos or loose styles alike.\u003c\/p\u003e \u003ch3\u003eCare and wearability\u003c\/h3\u003e\n\u003cp\u003eTo preserve their radiant glow, wipe gently with a soft cloth after wear and store in a dry place away from chemicals. Keep pearl components protected from harsh products and excessive moisture to maintain their natural luster over time.\u003c\/p\u003e \u003ch3\u003eKey benefits at a glance\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eLeaf-inspired pearl cluster creates a distinctive, nature-forward aesthetic\u003c\/li\u003e \u003cli\u003eDrop design delivers elegant movement and light-catching shine\u003c\/li\u003e \u003cli\u003eVersatile enough for formal occasions and polished everyday looks\u003c\/li\u003e \u003cli\u003eIdeal gift for her — thoughtful, stylish, and timeless\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936603320695,"sku":"SKU_1772806767670_479","price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Gold_stud_earrings_202604221955.jpg?v=1776884428"},{"product_id":"brincos-de-perolas-naturais-de-agua-doce-brincos-de-diamante-em-forma-de-lagrima-brincos-de-casamento-brincos-de-noivado-presente-para-madrinha-presente-para-mae","title":"Classic Pearl Teardrop Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eTimeless sophistication meets everyday practicality with our \u003cstrong\u003eClassic Pearl Teardrop Stud Earrings\u003c\/strong\u003e. A luminous pearl is artfully shaped into a graceful teardrop and set on a slim, comfortable stud—designed to elevate any look from desk to date night without overpowering your outfit.\u003c\/p\u003e \u003cp\u003eDesigned for how you actually wear jewelry, these earrings deliver a refined presence that suits a range of occasions:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOffice-to-evening versatility\u003c\/strong\u003e: pair with a crisp blouse or a knit sweater for a polished, approachable vibe that transitions smoothly into after-work plans.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eBridal and special occasions\u003c\/strong\u003e: the classic teardrop silhouette adds a subtle, romantic touch that complements wedding gowns and formal dresses alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday luxury\u003c\/strong\u003e: elevate casual outfits—think denim with a cashmere top or a simple little black dress—without feeling flashy.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhat makes these pearls special goes beyond their look. The teardrop shape is crafted to catch light from multiple angles, giving the pearl a soft, faceted glow that enhances any neckline. The stud design keeps the piece secure and comfortable for all-day wear, whether you’re at a meeting, a lunch date, or a weekend outing.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: To maintain their natural luster, wipe with a soft, dry cloth after wear and store in a jewelry pouch or soft box to minimize scratches. Avoid contact with harsh chemicals, perfumes, and lotions to preserve the pearl’s surface and shine.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eIdeal for\u003c\/strong\u003e: anyone who loves a classic, understated accessory that pairs with virtually any color or fabric. It’s an excellent gift for birthdays, anniversaries, or as a thoughtful bridal accessory for the \"something old\" element of a wedding day look.\u003c\/p\u003e \u003cp\u003eIn short, the Classic Pearl Teardrop Stud Earrings offer a refined, versatile option that completes your everyday ensemble while standing up to more formal occasions. If you’re seeking jewelry that delivers effortless elegance with a timeless pearl motif, these earrings are a thoughtful, lasting addition to any jewelry collection.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936603386231,"sku":"SKU_1772806745969_808","price":31.81,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_27ea58ae-10b4-4164-b64b-9e64d2b4b0bd.jpg?v=1774538180"},{"product_id":"a-womens-freshwater-pearl-ring-made-of-s925-sterling-silver-set-with-synthetic-zirconia-and-freshwater-pearls-it-features-a-trendy-clash-design-that-is-uniquely-stylish-making-it-a-great-gift-for-holidays-and-suitable-for-various-occasions","title":"Pearl Cuff Wrap Open Ring","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Pearl Cuff Wrap Open Ring—a delicate fusion of a single lustrous pearl and a slender, open-band design that wraps softly around the finger. This piece is built for everyday elegance and effortless sophistication, adding a touch of timeless charm to any look.\u003c\/p\u003e \u003cp\u003eDesigned with real-life wear in mind, the open wrap silhouette gives you a flexible fit across a range of finger sizes. Gently adjust the sides to nudge the ring into a snug, comfortable position, then enjoy a piece that moves with you—from desk to date night and everything in between.\u003c\/p\u003e \u003ch3\u003eWhy this ring stands out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece:\u003c\/strong\u003e A single, luminous pearl that instantly elevates your style with a natural, organic glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCuff wrap silhouette:\u003c\/strong\u003e A slim, architectural band that catches light from every angle, adding subtle shimmer without overpowering your look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAdjustable, open design:\u003c\/strong\u003e Flexible fit that’s easy to wear on different fingers and suitable for shared gifting among friends or loved ones.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e Pairs beautifully with casual outfits, professional wear, or formal attire, and layers gracefully with other slim rings for a personalized stack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfort-focused craftsmanship:\u003c\/strong\u003e Lightweight, smooth interior to glide over skin and fabrics without snagging.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003ePerfect for\u003c\/h3\u003e\n\u003cp\u003eAnyone who appreciates refined simplicity and a touch of natural beauty. It makes a thoughtful gift for birthdays, anniversaries, bridesmaids, or a treat-yourself moment for minimalists and pearl lovers alike.\u003c\/p\u003e \u003ch3\u003eHow to wear and care\u003c\/h3\u003e\n\u003cp\u003eWear it solo as a refined statement or combine it with a curated stack for a modern, layered look. To maintain its radiance, wipe gently with a soft cloth after wear, and store in a jewelry pouch to prevent scratches. Keep away from harsh chemicals, perfumes, and lotions to protect the pearl’s luster.\u003c\/p\u003e \u003ch3\u003eShopping guidance\u003c\/h3\u003e\n\u003cp\u003eThe Pearl Cuff Wrap Open Ring is designed for easy, everyday wear with a flexible fit. If you’re between sizes, choose the option that feels slightly tighter for a secure, comfortable hold that won’t slip off during the day.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936603418999,"sku":"SKU_1772744093549_387","price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/2_26d665ed-2b2a-4dcc-8cb9-9628ed998bb5.png?v=1774538182"},{"product_id":"dainty-freshwater-pearl-earrings-pearl-hoop-earrings-pearl-drop-earrings-gold-huggie-earrings-wedding-jewelry-christmas-gift-for-her","title":"Classic Pearl Drop Huggie Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eDiscover timeless charm with the Classic Pearl Drop Huggie Earrings. This elegant pair fuses a smooth, luminous pearl drop with a sleek hoop that hugs the ear, delivering a refined silhouette that transitions effortlessly from day to night.\u003c\/p\u003e \u003cp\u003eThe design centers on balance: a compact hoop that sits flush against the lobe paired with a single, eye-catching pearl drop that catches light from every angle. The result is a look that feels polished yet effortless, whether you’re coordinating with a tailored blazer or a casual knit.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy this pair stands out\u003c\/strong\u003e\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile silhouette:\u003c\/strong\u003e a close-to-ear hoop that creates clean lines and subtle sophistication with every movement.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLuminous focal point:\u003c\/strong\u003e a pearl drop that elevates everyday outfits into something more refined.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll-day comfort:\u003c\/strong\u003e lightweight construction designed for comfortable wear from dawn to dusk.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready elegance:\u003c\/strong\u003e a timeless jewelry staple that suits birthdays, anniversaries, or a meaningful “just because” moment.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eCare and wear tips: wipe gently with a soft cloth after wear and store in a jewelry pouch away from cosmetics and harsh chemicals to preserve its shine and luster.\u003c\/p\u003e \u003cp\u003eIdeal for anyone seeking a chic, minimalist statement—or for those who simply appreciate a piece that blends classic charm with modern ease. The Classic Pearl Drop Huggie Earrings are perfect for building a versatile jewelry collection, pairing seamlessly with other earrings, or serving as a thoughtful, enduring gift.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Silver","offer_id":56936603484535,"sku":"SKU_1772806809968_25","price":27.51,"currency_code":"EUR","in_stock":true},{"title":"Gold","offer_id":56936603517303,"sku":"SKU_1772806809968_26","price":27.51,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Gold_hoop_earrings_202604221955.jpg?v=1776884469"},{"product_id":"colar-delicado-de-perolas-de-agua-doce-com-diamantes-colar-de-perolas-com-diamantes-e-folha-de-ouro-joia-de-casamento-presente-de-noiva-presente-de-natal-para-ela","title":"Pearl Marquise Vine Drop Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eDiscover the Pearl Marquise Vine Drop Necklace—a refined fusion of luminous pearl artistry and a botanical-inspired silhouette. The centerpiece is a single lustrous pearl, framed by a slender marquise-shaped vine that wraps softly along the chain, catching light with every movement.\u003c\/p\u003e \u003cp\u003eWhy this necklace stands out:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eBotanical elegance\u003c\/strong\u003e: the marquise vine motif creates a graceful line that feels contemporary yet timeless, so it pairs beautifully with everything from a simple tee to a formal gown.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLuminous pearl centerpiece\u003c\/strong\u003e: a single, well-matched pearl delivers a clean, radiant focal point with natural iridescence.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: designed to sit at a flattering collarbone level, making it ideal for V-necklines, off-the-shoulder styles, or layered with other delicate pieces.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless daily wear\u003c\/strong\u003e: lightweight and comfortable, so you can elevate your look from desk to dinner without fuss.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift option\u003c\/strong\u003e: a refined, heirloom-leaning piece that suits anniversaries, birthdays, or bridal celebrations.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho it’s for: this pearl necklace is perfect for anyone who loves versatile elegance—bridal parties seeking subtle sophistication, professionals aiming to add polish to their wardrobe, or jewelry lovers who appreciate a quiet statement piece that doesn’t distract from the wearer’s personality.\u003c\/p\u003e \u003cp\u003eCare and longevity: Pearls are best cared for by keeping them separate from perfumes and cosmetics, wiping them gently with a soft cloth after wear, and storing them in a soft pouch or jewelry box to protect their natural luster.\u003c\/p\u003e \u003cp\u003eStyling tips: pair with a classic little black dress for evening events, a crisp white shirt for the office, or a deep V-neck for a minimalist yet impactful look. This necklace works beautifully as a standalone statement or layered with a fine chain for a modern, curated jewelry stack.\u003c\/p\u003e \u003cp\u003eTransform your jewelry collection with the Pearl Marquise Vine Drop Necklace—timeless, versatile, and crafted to enhance every moment. Add to cart and wear your signature sparkle with confidence.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936604238199,"sku":"SKU_1772806492251_295","price":34.4,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/give_a_flat_202604281730.jpg?v=1777393868"},{"product_id":"european-and-american-cross-border-inlaid-rhinestone-pearl-open-design-personalized-luxury-style-womens-bracelet","title":"Duo Pearl Pavé Cuff Bracelet","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Duo Pearl Pavé Cuff Bracelet—a refined fusion of classic pearl elegance and contemporary pavé sparkle. The design centers two lustrous pearls perched along a slender cuff, accented by micro pavé stones that catch the light with every movement.\u003c\/p\u003e \u003cp\u003eThis piece elevates any look, whether you’re stepping into a meeting, hosting a dinner, or enjoying a weekend outing. Its versatile silhouette pairs beautifully with a crisp blouse, a little black dress, or a layered jewelry stack for a curated, on-trend vibe.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDuo-pearl focal points\u003c\/strong\u003e deliver a modern twist on timeless pearl beauty.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMicro pavé detailing\u003c\/strong\u003e adds just-right shimmer to elevate the overall look without overpowering the pearls.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSlim cuff silhouette\u003c\/strong\u003e sits comfortably on the wrist and moves with you throughout the day.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e works as a standout stand-alone piece or as part of a curated bracelet stack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless gifting\u003c\/strong\u003e with a refined aesthetic that suits milestones, celebrations, or a thoughtful everyday treat.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho it’s for: jewelry lovers who appreciate a contemporary update to classic pearl design, and anyone seeking a versatile accessory that transitions from desk to date night with ease.\u003c\/p\u003e \u003cp\u003eCare and wear: to keep the Duo Pearl Pavé Cuff Bracelet looking its best, wipe gently with a soft cloth after wear, avoid harsh chemicals, and store separately to minimize scratches. With regular care, this piece remains a timeless addition to your jewelry collection.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936604336503,"sku":"SKU_1772642007834_738","price":32.68,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/2_afc8adf8-4304-4078-91ca-040c208d0476.jpg?v=1774538187"},{"product_id":"a-sweet-and-exquisite-faux-pearl-cat-paw-bracelet-for-women-featuring-a-high-end-design-that-is-versatile-and-fashionable","title":"Pearl Blossom Cluster Chain Bracelet","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Pearl Blossom Cluster Chain Bracelet — a graceful fusion of timeless pearl elegance and garden-inspired charm. A dainty chain is adorned with delicate pearl clusters that form tiny blossoms, creating subtle movement and a soft, radiant glow with every wrist turn.\u003c\/p\u003e \u003cp\u003eThis bracelet isn’t just jewelry; it’s a statement of refined, contemporary style. The floral clusters add dimension without bulk, so it sits smoothly against the skin and pairs beautifully with both wedding-day gowns and everyday outfits. Its balanced silhouette makes it easy to dress up a blazer for work or elevate a casual dress for an evening out.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eFloral pearl clusters\u003c\/strong\u003e along a slender chain create a three-dimensional, artistic feel that stands out from standard pearl bracelets.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e — ideal for weddings, anniversaries, or adding a touch of sophistication to daily looks. Layer it with other delicate bracelets for a curated, modern vibe.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless elegance\u003c\/strong\u003e — a refined silhouette that complements neutrals, pastels, and bold tones alike, making it a dependable go-to accessory.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare and wearability\u003c\/strong\u003e — designed to be comfortable for all-day wear; wipe with a soft cloth after use and store away from harsh chemicals to preserve its luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhy this bracelet works for you: it delivers a cultivated, nature-inspired aesthetic without overpowering your outfit. It’s perfect for someone who loves pearls but wants a fresh, floral twist, whether shopping for a special gift or treating themselves. The Pearl Blossom Cluster Chain Bracelet is a quiet luxury piece that elevates every moment, from ordinary days to unforgettable occasions.\u003c\/p\u003e \u003cp\u003eReady to embrace a bloom-forward, pearl-driven look? Add the Pearl Blossom Cluster Chain Bracelet to your cart and wear a symbol of understated elegance that travels well from day to night.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936604205431,"sku":"SKU_1772642157704_180","price":31.81,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_c0843b1b-d5f2-4606-9314-43b2dd2b288d.jpg?v=1774538187"},{"product_id":"1-pair-womens-elegant-earrings-vintage-minimalist-style-faux-pearl-rhinestone-studded-fashion-ear-jewelry","title":"Pearl Huggie Paved Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Pearl Huggie Paved Drop Earrings — a refined balance of timeless pearl beauty and contemporary sparkle. Designed to hug the ear in a sleek hoop, this pair features a lustrous pearl drop framed by a delicate pavé detail that catches light from every angle. It’s the kind of jewelry that transitions effortlessly from desk to dinner, adding a touch of understated glamour to any look.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTwo-tier allure in a single piece:\u003c\/strong\u003e A snug huggie silhouette paired with a shimmering pavé drop and pearl accent for a modern take on classic elegance.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile for any occasion:\u003c\/strong\u003e Ideal for daily wear at the office, date nights, weddings, and special events when you want a subtle yet memorable finish.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLustrous pearl meets micro-sparkle:\u003c\/strong\u003e The smooth pearl provides a soft glow while the pavé accents deliver just enough sparkle to elevate your outfit without overwhelming it.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfortable, secure design:\u003c\/strong\u003e Crafted to sit flush with the ear and stay comfortable for hours, making them a reliable choice for all-day wear.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho these are for\u003c\/strong\u003e: Perfect for pearl enthusiasts who crave a contemporary edge, for anyone building a refined jewelry collection, or as a thoughtful gift for birthdays, anniversaries, or bridesmaids who appreciate quiet luxury.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e\u003cbr\u003eTo preserve their brilliance, wipe with a soft cloth after wear and store in a jewelry box or pouch. Keep away from harsh chemicals, lotions, and excessive moisture. Put on last when dressing to protect the pearl’s nacre and the pavé from cosmetics and perfume.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eStyling tips\u003c\/strong\u003e\u003cbr\u003ePair with a sleek blouse and tailored blazer for a polished office look, or contrast with a satin gown for evening elegance. For a cohesive mini-ensemble, balance with smaller earrings or a delicate pearl necklace to echo the pearl drop without competing with the pavé detail.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936604303735,"sku":"SKU_1772743689911_522","price":29.23,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/3d334bd3-9c0f-46b9-919a-eb98d2766e6b.jpg?v=1774538188"},{"product_id":"1-ladies-anniversary-ring-fashionable-4-prong-synthetic-zirconia-latin-style-ring-suitable-for-womens-daily-casual-banquet-party-wear-gift","title":"Twisted Fresh Water Pearl Accent Ring","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Twisted Fresh Water Pearl Accent Ring—a refined, sculpted piece that brings subtle drama to any look. The twist in the band creates gentle movement as you wear it, while a single, lustrous freshwater pearl sits as a timeless focal point. This is pearl jewelry with personality, designed to elevate everyday outfits and sparkle under evening lights alike.\u003c\/p\u003e \u003cp\u003eWhat makes this pearl ring stand out?\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTwisted band silhouette\u003c\/strong\u003e: A delicate swirl that adds texture and catches the light from every angle, so your ring feels dynamic whether you’re at the desk or on the dance floor.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFreshwater pearl accent\u003c\/strong\u003e: Each pearl offers natural iridescence and a unique glow, ensuring no two rings look exactly alike—a true, inherent charm for your jewelry collection.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: This ring pairs effortlessly with other rings, making it ideal for a layered stack or worn solo as a quiet statement piece. It complements a wide range of metals and outfits, from casual denim to dressy satin.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday elegance\u003c\/strong\u003e: Lightweight and comfortable enough for daily wear, yet refined enough for special occasions, weddings, or anniversaries.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift\u003c\/strong\u003e: A timeless choice for birthdays, milestones, or a “just because” moment for someone who loves classic pearls with a modern twist.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho will love it? Pearls appeal to anyone drawn to understated luxury and a touch of antique charm with a contemporary twist. It’s especially well-suited for someone building a versatile jewelry capsule—a single ring that pairs beautifully with other pieces while still standing out on its own.\u003c\/p\u003e \u003cp\u003eCare and wear tips to keep the ring looking its best: remove before swimming or heavy watersports, avoid household chemicals, and wipe gently with a soft cloth after wear to preserve the pearl’s natural luster. When not in use, store in a soft pouch or jewelry box to prevent scratches and tangles with other pieces.\u003c\/p\u003e \u003cp\u003eReady to add a touch of sculptural elegance to your jewelry lineup? The Twisted Fresh Water Pearl Accent Ring is a feminine, enduring choice that blends nature’s glow with contemporary design. \u003cstrong\u003eShop now\u003c\/strong\u003e to secure this distinctive pearl accent ring and elevate your everyday style.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Silver \/ 5","offer_id":56936604369271,"sku":"SKU_1772743775137_875","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 6","offer_id":56936604402039,"sku":"SKU_1772743775137_788","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 7","offer_id":56936604434807,"sku":"SKU_1772743775137_622","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 8","offer_id":56936604467575,"sku":"SKU_1772743775137_456","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 9","offer_id":56936604500343,"sku":"SKU_1772743775137_457","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 10","offer_id":56936604533111,"sku":"SKU_1772743775137_804","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 11","offer_id":56936604565879,"sku":"SKU_1772743775137_540","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 12","offer_id":56936604598647,"sku":"SKU_1772743775137_194","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 5","offer_id":56936604631415,"sku":"SKU_1772743775137_889","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 6","offer_id":56936604664183,"sku":"SKU_1772743775137_662","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 7","offer_id":56936604696951,"sku":"SKU_1772743775137_762","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 8","offer_id":56936604729719,"sku":"SKU_1772743775137_284","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 9","offer_id":56936604762487,"sku":"SKU_1772743775137_808","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 10","offer_id":56936604795255,"sku":"SKU_1772743775137_718","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 11","offer_id":56936604828023,"sku":"SKU_1772743775137_129","price":32.68,"currency_code":"EUR","in_stock":true},{"title":"Gold \/ 12","offer_id":56936604860791,"sku":"SKU_1772743775137_692","price":32.68,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1723343827541-677c044203c4416c935537def0f646d9-goods_8a9b0815-8826-4d52-a15e-483ba7097331.jpg?v=1774538188"},{"product_id":"vintage-imitation-pearl-bracelet-multi-imitation-pearl-smooth-beads-look-fine-jewelry-gift-suitable-for-daily-wear-weddings-parties-special-occasions-year-round-elegant-accessory","title":"Luna Bead Adjustable Bracelet","description":"\u003cdiv\u003e\n\u003cp\u003eThe Luna Bead Adjustable Bracelet brings a touch of moonlit elegance to your daily look. Designed around a simple, intuitive sliding mechanism, this bracelet sizes itself to fit with effortless finesse—so you get a secure, comfortable feel without fumbling with clasps. \u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless adjustability.\u003c\/strong\u003e A smooth sliding knot lets you dial in the perfect fit for any wrist size, ensuring it stays snug when you move and sit softly when you rest.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCelestial bead palette.\u003c\/strong\u003e Deep, night-sky hues paired with subtle silver accents evoke lunar glow, making it seamless to wear from casual days to evening outings.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-profile, durable design.\u003c\/strong\u003e The bead arrangement sits close to the skin for a refined silhouette, while the cords and bead cores are chosen to endure day‑to‑day wear without losing shape.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling.\u003c\/strong\u003e Layer it with other bracelets for a curated, boho-chic stack or wear solo as a delicate focal point. It transitions from workdays to weekends with ease.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready for celestial dreamers.\u003c\/strong\u003e A thoughtful present for birthdays, anniversaries, or “just because” moments—perfect for astrology lovers, moon-gazers, or anyone drawn to moonlit aesthetics.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho should reach for the Luna Bead Adjustable Bracelet? If you crave a jewelry piece that blends accessibility with a touch of magic, this bracelet is for you. It’s ideal for minimalists who appreciate subtle sparkle, travelers who need reliable fit on the go, and anyone building a layered look that doesn’t overpower their outfit. \u003c\/p\u003e \u003cp\u003ePractical use tips: start with a comfortable fit around your wrist, then adjust as needed for activity or layering. Pair it with a silver chain necklace or a set of thin, stacking bracelets to echo the lunar theme without competing for attention. To care, wipe gently with a soft cloth after wear and avoid prolonged exposure to water or harsh chemicals to preserve the bead colors and glow.\u003c\/p\u003e \u003cp\u003eEmbrace the quiet radiance of the night sky with the Luna Bead Adjustable Bracelet—a small piece with a big impact, designed to accompany you from sunup to starlight.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936605352311,"sku":"SKU_1772562414359_759","price":31.81,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_c6cb97a6-6cd8-4d5d-ae70-0cbb392cb68d.jpg?v=1774538195"},{"product_id":"2pcs-set-fashionable-womens-vintage-floral-lily-pendant-synthetic-leaf-metal-antique-bronze-earrings-for-daily-wear-parties-and-gifting","title":"Silver Floral Lily Pearl Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eSilver Floral Lily Pearl Earrings fuse nature-inspired grace with timeless pearl sophistication. A delicate lily motif in a polished silver frame cradles a luminous freshwater pearl, catching light from every angle and adding a subtle, romantic glow to any look.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDesign \u0026amp; materials\u003c\/strong\u003e: Sterling silver setting with a single freshwater pearl creates a refined, garden-inspired silhouette that feels both modern and timeless.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight comfort\u003c\/strong\u003e: Thoughtfully sized and crafted for everyday wear, these earrings sit securely without weighing you down.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSecure, easy wear\u003c\/strong\u003e: Snap-on butterfly backs keep the earrings in place from desk to dance floor, so you can move with confidence.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile style\u003c\/strong\u003e: Perfect for weddings and bridesmaids, but equally at home with corporate attire, date nights, or weekend brunch—elevating any outfit with a touch of luxe simplicity.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCaring for care and longevity\u003c\/strong\u003e: Clean with a soft, dry cloth after wear; store in a jewelry pouch to protect the silver and pearl’s natural luster; avoid contact with harsh chemicals and chlorine.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready charm\u003c\/strong\u003e: An elegant choice for anniversaries, birthdays, or “just because” moments, beautifully suited for someone who loves understated, nature-inspired jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThese earrings are crafted for the discerning wearer who values a graceful, botanical-inspired accent without overpowering the overall look. The silver lily silhouette paired with a single pearl creates a timeless statement that complements white dresses, dark formal wear, or casual outfits with a hint of sophistication.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eIdeal for\u003c\/strong\u003e: brides seeking a delicate, flower-inspired detail, pearl lovers building a refined jewelry collection, or anyone looking for a versatile pair that transitions from day to night with ease. If you’re choosing a thoughtful gift, these earrings offer a refined, memorable gesture that’s as elegant as it is wearable.\u003c\/p\u003e \u003cp\u003eElevate your jewelry edit with a pair that captures the quiet beauty of a garden bloom and the classic allure of a pearl—the Silver Floral Lily Pearl Earrings.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936605385079,"sku":"SKU_1772743882932_669","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/31a98068-f6bf-4c34-9dae-9a417fbebcea.jpg?v=1774538211"},{"product_id":"hot-classic-a-z-heart-lnitial-letter-bracelet-women-temperament-lmitation-imitation-pearl-bead-bracelet-for-women-jewelry-gift","title":"A-Z Pearl Beaded Bracelet","description":"\u003cdiv\u003e\n\u003cp\u003eThe A-Z Pearl Beaded Bracelet is a handcrafted fusion of classic elegance and personalized charm. This piece combines the timeless luster of freshwater pearl beads with bold alphabet accents, letting you spell out initials, a name, or a short word that holds meaning for you. It’s more than a bracelet—it’s a wearable message you can wear every day.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePersonalized alphabet accents\u003c\/strong\u003e—includes A–Z letter beads so you can craft names, initials, or meaningful words, creating a truly one-of-a-kind piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLustrous pearl centerpiece\u003c\/strong\u003e—high-quality freshwater pearls provide a radiant, natural glow that elevates everyday outfits and special occasions alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSecure, flexible fit\u003c\/strong\u003e—designed on a durable elastic cord for a comfortable, one-size-fits-most profile that moves with you without snagging or pinching.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eBalanced design\u003c\/strong\u003e—careful spacing between pearls and letter beads ensures legibility and a refined silhouette for wrists of all sizes.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e—wear it solo for a minimalist statement or layer with other bracelets to create a chic, personalized stack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gifting option\u003c\/strong\u003e—an ideal present for birthdays, graduations, bridesmaids, or a special friend who loves meaningful jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThe A-Z Pearl Beaded Bracelet is ideal for anyone who appreciates subtle luxury with a personal twist. It’s perfect for students, professionals, and creatives who want a daily reminder of what matters most—whether that’s a name, an initial, or a word that inspires them. This is jewelry that speaks softly but clearly, turning small details into a memorable, wearable gesture.\u003c\/p\u003e \u003cp\u003eCare tips to keep it sparkling: wipe gently with a soft, damp cloth after wear, avoid prolonged exposure to perfumes and chemicals, and store in a jewelry pouch away from sharp objects. With proper care, the A-Z Pearl Beaded Bracelet will continue to gleam and shine as your daily companion and a cherished keepsake.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"A","offer_id":56936605516151,"sku":"SKU_1772641593617_653","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"B","offer_id":56936605548919,"sku":"SKU_1772641593617_670","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"C","offer_id":56936605581687,"sku":"SKU_1772641593617_94","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"D","offer_id":56936605614455,"sku":"SKU_1772641593617_945","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"E","offer_id":56936605647223,"sku":"SKU_1772641593617_112","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"F","offer_id":56936605679991,"sku":"SKU_1772641593617_780","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"G","offer_id":56936605712759,"sku":"SKU_1772641593617_282","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"H","offer_id":56936605745527,"sku":"SKU_1772641593617_506","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"I","offer_id":56936605778295,"sku":"SKU_1772641593617_730","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"J","offer_id":56936605811063,"sku":"SKU_1772641593617_638","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"K","offer_id":56936605843831,"sku":"SKU_1772641593617_482","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"L","offer_id":56936605876599,"sku":"SKU_1772641593617_860","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"M","offer_id":56936605909367,"sku":"SKU_1772641593617_469","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"N","offer_id":56936605942135,"sku":"SKU_1772641593617_429","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"O","offer_id":56936605974903,"sku":"SKU_1772641593617_385","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"P","offer_id":56936606007671,"sku":"SKU_1772641593617_259","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Q","offer_id":56936606040439,"sku":"SKU_1772641593617_136","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"R","offer_id":56936606073207,"sku":"SKU_1772641593617_729","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"S","offer_id":56936606105975,"sku":"SKU_1772641593617_143","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"T","offer_id":56936606138743,"sku":"SKU_1772641593617_939","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"U","offer_id":56936606171511,"sku":"SKU_1772641593617_201","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"V","offer_id":56936606204279,"sku":"SKU_1772641593617_238","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"W","offer_id":56936606237047,"sku":"SKU_1772641593617_383","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"X","offer_id":56936606269815,"sku":"SKU_1772641593617_932","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Y","offer_id":56936606302583,"sku":"SKU_1772641593617_865","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Z","offer_id":56936606335351,"sku":"SKU_1772641593617_885","price":29.23,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/e2f6f12a8af88ae56b52ea007ef9dae0.jpg?v=1774538195"},{"product_id":"1pc-elegant-double-layer-faux-pearl-tassel-necklace-vintage-style-zinc-alloy-adjustable-bead-count-for-daily-party-wear-all-season-accessory","title":"Pearl Y Chain Layered Necklace","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Y Chain Layered Necklace\u003c\/strong\u003e — a refined, everyday piece that elevates your look with a timeless pearl touch and a modern Y-shaped silhouette.\u003c\/p\u003e \u003cp\u003eDesigned as a single, layered statement, this necklace combines delicate pearl accents with a slim chain that drapes in a graceful Y. The result is a versatile piece that works whether you're pairing it with a crisp blouse for the office or a sleek dress for an evening out.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy this piece stands out\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOne-piece layered look:\u003c\/strong\u003e achieve the chic, layered effect without juggling multiple necklaces.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl accents:\u003c\/strong\u003e lustrous beads lend a touch of sophistication that catches the light from every angle.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless pairing:\u003c\/strong\u003e complements necklines from crew to sweetheart, and blends seamlessly with other jewelry pieces.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday elegance:\u003c\/strong\u003e a timeless silhouette that stays polished from morning meetings to after-hours events.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho it's for\u003c\/strong\u003e — ideal for anyone who wants to add a touch of luxury to their everyday wardrobe: professionals seeking a polished look, students stepping into the workplace, or anyone who appreciates a subtly elevated accessory that pairs with almost anything.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e — wipe gently with a soft cloth after wear, store in a cool, dry place, and avoid contact with harsh chemicals or water to preserve the pearl luster and the chain’s finish.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCompetitive edge\u003c\/strong\u003e — this Pearl Y Chain Layered Necklace delivers the visual impact of a two-layer design in a single piece, reducing tangles and coordination hassles while remaining flexible enough to wear solo or layered with other pieces for different occasions.\u003c\/p\u003e \u003cp\u003eReady to elevate your jewelry collection? Add the Pearl Y Chain Layered Necklace to your cart and enjoy effortless sophistication that fits any occasion.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936605319543,"sku":"SKU_1772562630489_949","price":34.4,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Product_on_satin_fabric_202605041512.jpg?v=1777904077"},{"product_id":"brincos-de-perolas-verdadeiras-com-borlas-brincos-pendentes-de-perolas-de-agua-doce-joias-delicadas-de-perolas-brincos-de-noiva-joias-de-casamento-presente-para-madrinhas","title":"Pearl Chain Trio Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate your everyday look with the Pearl Chain Trio Drop Earrings—the perfect harmony of classic pearl charm and contemporary chain drama. Three luminous pearls gracefully dangle along a delicate chain, catching light from every angle as you move.\u003c\/p\u003e \u003cp\u003eWhy they stand out\u003c\/p\u003e \u003cul\u003e \u003cli\u003eTriple pearl cascade: A refined trio creates subtle movement and visual interest without overpowering your outfit.\u003c\/li\u003e \u003cli\u003eContemporary chain silhouette: The slender chain provides a modern frame that lengthens the profile and complements both neutral and vibrant palettes.\u003c\/li\u003e \u003cli\u003eDay-to-night versatility: Equally at home with a tailored blazer or a sleek evening dress, these earrings adapt to any occasion.\u003c\/li\u003e \u003cli\u003eComfortable, lightweight wear: Designed to feel barely there while still making a polished impact.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho they’re for\u003c\/p\u003e \u003cul\u003e \u003cli\u003eProfessionals seeking a polished but understated accessory for meetings, presentations, and client dinners.\u003c\/li\u003e \u003cli\u003eBridesmaids or wedding guests who want timeless pearls with a modern twist.\u003c\/li\u003e \u003cli\u003eGifts for jewelry lovers who appreciate a graceful, multipurpose pair that pairs with many outfits.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eStyle and care tips\u003c\/p\u003e \u003cul\u003e \u003cli\u003ePair with a crisp white shirt or a sleek black dress to let the pearl drops shine.\u003c\/li\u003e \u003cli\u003eWear with other delicate chains for a layered, fashion-forward look.\u003c\/li\u003e \u003cli\u003eStore in a soft pouch and wipe with a gentle cloth after wearing to preserve their luster.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936606859639,"sku":"SKU_1772806689536_298","price":24.93,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Gold_pearl_threader_202604221722.jpg?v=1776874966"},{"product_id":"a-pair-of-exquisite-geometric-patterned-hollow-carved-symmetrical-elegant-vintage-silvery-stainless-steel-tassel-drop-earrings-perfect-for-daily-wear-or-party-gifts","title":"Pearl Chandelier Filigree Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate your evening silhouette with the Pearl Chandelier Filigree Drop Earrings—a refined celebration of vintage charm and modern polish. This statement pair pairs cascading pearl drops with intricate filigree lattice, creating a luminous, eye-catching silhouette that moves beautifully as you turn. The result is a timeless accessory that feels both romantic and effortless, perfect for making a memorable impression at any formal moment.\u003c\/p\u003e \u003ch3\u003eWhy these earrings stand out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eCascading pearl drama\u003c\/strong\u003e—tiered drops drape gracefully to frame the neckline and catch light from every angle, adding a soft, iridescent glow to your look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFiligree craftsmanship\u003c\/strong\u003e—delicate metalwork provides texture and depth, giving the earrings a vintage-inspired elegance with contemporary, clean lines.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile sophistication\u003c\/strong\u003e—equally at home with a sleek gown for a gala, a wedding guest ensemble, or upscale date night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight comfort\u003c\/strong\u003e—designed for long wear so you can glow all evening without weighing you down.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless styling\u003c\/strong\u003e—pairs well with pearls, metallics, and jewel tones, amplifying both classic and modern palettes.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal for\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eBridal jewelry that adds graceful drama without overpowering the dress\u003c\/li\u003e \u003cli\u003eWedding guests seeking a refined, standout accessory\u003c\/li\u003e \u003cli\u003eGlamourous cocktail nights or black-tie events\u003c\/li\u003e \u003cli\u003eShowcasing a polished, chic look with a tailored blazer or evening gown\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eHow to wear\u003c\/h3\u003e\n\u003cp\u003eLet the pearls take center stage by pairing these Earrings with a simple silhouette—think a sleek black dress, a timeless satin gown, or a soft lace ensemble. Coordinate with a delicate bracelet or a single pearl ring to maintain balance while letting the chandelier drop create the focal point of your ensemble.\u003c\/p\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch or jewelry box to protect the filigree details and prevent scratching the pearl surfaces.\u003c\/li\u003e \u003cli\u003eAvoid contact with perfumes, hairsprays, and harsh cleaners; wipe gently with a soft cloth after wear.\u003c\/li\u003e \u003cli\u003eClean pearls with a damp, soft cloth and allow to air-dry away from direct heat or sunlight.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThe Pearl Chandelier Filigree Drop Earrings are a timeless addition to any jewelry collection, designed to elevate special occasions and everyday elegance alike. When you want a look that feels curated, confident, and a touch romantic, these earrings deliver a luminous statement without overpowering your natural grace.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936606925175,"sku":"SKU_1772743953831_577","price":32.68,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/85b63ff4-4a34-4128-96f8-d9f2e7d24928.jpg?v=1774538201"},{"product_id":"an-asymmetrical-pearl-decorative-necklace-for-women-elegant-and-stylish-perfect-for-everyday-wear","title":"Baroque Coin Pearl Strand Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eElevate every moment with the Baroque Coin Pearl Strand Necklace—the ultimate fusion of organic, sculptural beauty and modern polish. This single strand pairs the irregular, artful shapes of Baroque pearls with the crisp, luminous discs of coin pearls, creating a necklace that reads as both timeless and decisively contemporary. The result is a piece that catches light from every angle, adding depth and dimension to any neckline.\u003c\/p\u003e \u003ch2\u003eWhy this Baroque Coin Pearl Strand Necklace stands apart\u003c\/h2\u003e\n\u003cp\u003eTwo pearl aesthetics converge in a necklace that refuses to be ordinary. The Baroque pearls contribute rich texture and a natural, museum-worthy charm, while the coin pearls provide a geometric rhythm that feels sleek and current. The combination offers a versatile statement—elegant enough for formal events, yet refined enough to elevate casual daywear without shouting for attention.\u003c\/p\u003e \u003ch3\u003eKey benefits\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eDistinctive contrast\u003c\/strong\u003e between the organic irregularity of Baroque pearls and the flat, lustrous surface of coin pearls creates visual interest from every angle.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless versatility\u003c\/strong\u003e pairs beautifully with classic silhouettes and contemporary outfits alike, making it a flexible addition to any jewelry collection.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless elegance\u003c\/strong\u003e adds immediate polish to necklines such as off-the-shoulder, boat neck, or V-neck styles, transforming everyday looks into moments of refined charm.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-key luxury\u003c\/strong\u003e—a refined statement that doesn’t rely on flash, but on the natural beauty and glow of genuine pearls.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eIdeal for\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eModern brides seeking a touch of organic luxury on their wedding day\u003c\/li\u003e \u003cli\u003eAnyone wanting a standout necklace that can transition from office wear to after-hours events\u003c\/li\u003e \u003cli\u003eGift-worthy jewelry for anniversaries, birthdays, or milestone celebrations\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003e styling ideas\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eWear it with a bateau or boat-neck top to frame the necklace and highlight the interplay between Baroque and coin pearls.\u003c\/li\u003e \u003cli\u003eLet it stand alone as a statement piece, or pair it with a delicate pendant for a curated layered look.\u003c\/li\u003e \u003cli\u003eCoordinate with metals that echo the necklace’s luster—silver or white gold undertones to maintain a cool, modern aesthetic.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eCaring for your Baroque Coin Pearl Strand Necklace\u003c\/h2\u003e\n\u003cp\u003ePearls are shimmering, delicate gems. Wipe the strand gently with a soft, damp cloth after wearing to remove oils or cosmetics, and store it in a soft pouch or jewelry box separate from harder pieces to prevent scratches. Avoid contact with perfume, hairspray, and cleaning agents, and refrain from exposing the necklace to ultrasonic cleaners or harsh chemicals.\u003c\/p\u003e \u003ch2\u003eWhat you’re getting\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eBaroque pearl strand\u003c\/strong\u003e featuring the irregular, organic shapes that give each piece its distinctive character\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCoin pearl accents\u003c\/strong\u003e for a clean, contemporary disc element that enhances light reflection\u003c\/li\u003e \u003cli\u003eA single-strand design crafted to offer a balanced, elegant silhouette against a range of necklines\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eReady to elevate your jewelry collection with a piece that merges artful imperfection with modern polish? Add the Baroque Coin Pearl Strand Necklace to your cart and experience how a pearl necklace can redefine everyday luxury.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936606826871,"sku":"SKU_1772560562756_959","price":34.4,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/openart-image_0nhV8Uve_1772638231529_raw.jpg?v=1774538202"},{"product_id":"an-elegant-lapis-lazuli-and-faux-pearl-necklace-uniquely-beaded-handcrafted-as-a-birthday-gift-for-women","title":"Midnight Lapis Pearl Pendant Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Midnight Lapis Pearl Pendant Necklace—a refined fusion of celestial depth and luminous elegance. This pendant pairs a mesmerizing midnight-blue lapis gemstone with a pristine pearl, creating a timeless centerpiece that shifts from subtle daytime polish to unforgettable evening glamour.\u003c\/p\u003e \u003cp\u003eWhat makes this necklace stand out:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eStriking contrast\u003c\/strong\u003e: The deep, velvet-blue of midnight lapis against the soft glow of a pearl creates a sophisticated two-tone focal point that instantly elevates any outfit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile silhouette\u003c\/strong\u003e: A delicate pendant suspended on a slim chain anchors your look without overpowering it, making it perfect for both minimalists and those who love a classic, refined style.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless pairing\u003c\/strong\u003e: Works beautifully with monochrome wardrobes, office-ready ensembles, or special-occasion attire, and it layers gracefully with other necklaces for a curated, personal statement.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eQuality that endures\u003c\/strong\u003e: Designed to be worn from day to night, this piece brings a touch of timeless charm to any collection and makes a meaningful gift for birthdays, anniversaries, or “just because.”\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for lovers of elegant, nature-inspired jewelry, this Midnight Lapis Pearl Pendant Necklace is crafted to highlight the juxtaposition of a velvety blue gemstone and a luminous pearl. Whether you’re dressing for a formal event, a romantic date, or a stylish day at the office, this piece adds a refined glow that’s unmistakably you.\u003c\/p\u003e \u003cp\u003eCare and wear tips: store gently to avoid scratches, wipe with a soft cloth after wear, and keep away from harsh chemicals to preserve the stone’s luster and the pearl’s sheen.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936606892407,"sku":"SKU_1772562310998_910","price":38.7,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Product_on_satin_fabric_202605041512_1.jpg?v=1777904077"},{"product_id":"anel-de-noivado-com-perola-natural-akoya-vintage-perola-branca-ouro-rosa-anel-de-moissanita-alianca-de-casamento-presente-de-aniversario-aneis-para-mulheres","title":"Pearl Blossom Accent Promise Ring","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Blossom Accent Promise Ring\u003c\/strong\u003e is a delicate, nature-inspired piece designed to symbolize commitment while keeping your everyday style timeless and versatile. This ring blends a luminous pearl centerpiece with intimate blossom accents, creating a look that feels handcrafted and thoughtfully romantic.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece\u003c\/strong\u003e: A radiant pearl sits at the heart of the design, delivering a soft, iridescent glow that elevates any outfit—from casual denim to an elegant blouse.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eBlossom accents\u003c\/strong\u003e: Tiny floral motifs weave around the band, adding a subtle botanical charm that captures the beauty of a garden in bloom.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMeaningful promise\u003c\/strong\u003e: Crafted with the intention of a promise ring, this piece carries a personal message of devotion and growth without needing a traditional engagement piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile wearability\u003c\/strong\u003e: The refined silhouette and balanced proportions make it effortless to pair with other rings or wear solo for a quiet, everyday statement.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThis ring is ideal for anyone who loves garden-inspired jewelry with a refined edge—perfect as a heartfelt gift for anniversaries, milestones, or a meaningful “just because” moment. It speaks to lovers of timeless design and those who appreciate small details that tell a larger story.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and wear tips\u003c\/strong\u003e: To keep the pearl luminous, wipe the ring with a soft cloth after wearing and avoid harsh chemicals. Store separately from other jewelry to prevent scratches, and remove the ring during activities that could expose it to rough surfaces or chlorine.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936606957943,"sku":"SKU_1772806584993_817","price":34.4,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_85b3c575-32da-4ce9-bdbb-2bb98ca316b7.jpg?v=1774538202"},{"product_id":"womens-fashion-pendant-ring-imitation-pearl-love-earrings-personality-daily-wear-date-gift-creative-fashion-jewelry-low-allergy","title":"Heart Huggie Earrings with Beadwork","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eHeart Huggie Earrings with Beadwork\u003c\/strong\u003e fuse a delicate heart motif with artisan beadwork, delivering a fresh take on the classic hoop. Each pair captures a touch of whimsy and a hint of artistry, turning everyday wear into something distinctly beautiful that catches the light with every move.\u003c\/p\u003e \u003cp\u003eDesigned for comfort and everyday versatility, these huggie earrings sit close to the ear for a secure, quintessentially chic silhouette. The smooth inner curve glides on easily, while the beadwork adds texture and color that elevates even the simplest outfit—from a white tee to a little black dress.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eArtisan beadwork\u003c\/strong\u003e—tiny beads are carefully applied to form a heart accent along the hoop, giving each pair a handmade, textured finish.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eHuggie hoop design\u003c\/strong\u003e—compact, low-profile hoop that hugs the earlobe for a comfortable, everyday fit.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSkin-friendly construction\u003c\/strong\u003e—crafted with a hypoallergenic base to minimize irritation and suit sensitive ears.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility\u003c\/strong\u003e—works beautifully with casual looks or dressier ensembles, making them a reliable go-to accessory.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful gift option\u003c\/strong\u003e—a charming, handcrafted piece that’s ready to gift to someone who appreciates unique jewelry.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eIdeal for\u003c\/h3\u003e\n\u003cp\u003eAnyone who loves subtle sparkle, textured detail, or handmade accessories. They’re perfect for gifting a loved one, adding a tasteful touch to your jewelry stack, or treating yourself to a piece that feels special without being overpowering.\u003c\/p\u003e \u003ch3\u003eUse cases\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eEveryday wear with jeans and a tee for a touch of personality.\u003c\/li\u003e \u003cli\u003eLayered with other delicate hoops or studs for a curated, multi-piece look.\u003c\/li\u003e \u003cli\u003ePairing with a dress or blouse for a polished, subtle statement at events or dinners.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo maintain the beadwork and finish, store in a soft pouch away from moisture, apply perfumes and lotions before putting them on, and wipe gently with a dry cloth after wear. Avoid swimming or showering while wearing them to preserve the bead texture and the hoop’s finish. Since beadwork is handcrafted, each pair may have slight, beautiful variations that make your earrings uniquely yours.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936607449463,"sku":"SKU_1772562459738_921","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/41bcf018b5bc69c54c7f34142a0c49a4.jpg?v=1774538208"},{"product_id":"elegant-earrings-for-women-featuring-a-stylish-and-luxurious-design-adorned-with-small-beads","title":"Pearl Bubble Hoop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eMeet the Pearl Bubble Hoop Earrings—a modern twist on a timeless favorite. The luminous pearl accents are arranged along a sleek hoop, creating a buoyant, bubble-like silhouette that catches the light from every angle. This is jewelry that moves with you, adding a soft glow to every moment.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eBubble silhouette, pearl glow:\u003c\/strong\u003e A refined hoop lined with pearl accents for a look that’s at once contemporary and classic.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight comfort:\u003c\/strong\u003e Designed for day-to-night wear, the slim hoop rests gently on the ear for all-day ease without heaviness.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFrom casual to couture:\u003c\/strong\u003e Elevate a denim look, sharpen your office style, or add subtle sparkle to an evening dress—the versatility you crave.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless gifting:\u003c\/strong\u003e An elegant choice for birthdays, anniversaries, bridesmaids, or a thoughtful surprise for someone special.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance brilliance:\u003c\/strong\u003e Pearl accents with a durable finish that cleans easily and stays radiant with simple care.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThe Pearl Bubble Hoop Earrings are ideal for anyone who loves jewelry that does double duty—polished enough for a wedding guest list, relaxed enough for everyday errands, and stylish enough to become a signature piece. They pair beautifully with a blazer for a polished workday look, or with a simple dress for a refined evening out. Layer them with minimalist studs for added dimension, or wear solo to let the pearl detailing stand in the spotlight.\u003c\/p\u003e \u003cp\u003eCare tips: to preserve the luster, wipe with a soft cloth after wear and store in a dry, lined jewelry box. Keep them away from harsh chemicals, perfumes, and excessive moisture to maintain their glow over time.\u003c\/p\u003e \u003cp\u003eExperience the refined charm and versatile appeal of Pearl Bubble Hoop Earrings—a small detail with unmistakable impact. Add them to your collection today and enjoy a timeless touch of sophistication in every moment.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936608137591,"sku":"SKU_1772562690376_170","price":29.23,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/7519eb62-0f2a-419b-bda1-7e64cb747135.jpg?v=1774538208"},{"product_id":"brincos-de-perolas-e-diamantes-brincos-de-perolas-de-prata-esterlina-brincos-de-diamantes-brincos-de-noiva-brincos-de-perolas-para-casamento-brincos-de-noivado","title":"Fresh Water Pearl Blossom Cluster Drop Studs","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eFresh Water Pearl Blossom Cluster Drop Studs\u003c\/strong\u003e bring a touch of nature’s quiet luxury to any moment.\u003c\/p\u003e\n\u003cp\u003eA bouquet of luminous freshwater pearls forms a delicate blossom that sits close to the ear, then trails into a subtle drop silhouette. Each pearl showcases natural variation in size and iridescence, ensuring no two earrings are exactly alike—like a tiny, living bouquet you can wear.\u003c\/p\u003e \u003ch2\u003eWhy they stand out\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eOrganic beauty\u003c\/strong\u003e: pearl clusters mimic a blooming flower with soft, rounded edges and that distinctive freshwater luster.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile appeal\u003c\/strong\u003e: elegant enough for a wedding or evening event, yet understated enough for everyday outfits like blouses, knitwear, or a blazer.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight comfort\u003c\/strong\u003e: designed for comfortable wear during long days or nights out, so you can enjoy the sparkle without fatigue.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless styling\u003c\/strong\u003e: pairs beautifully with pearl necklaces or casual denim for a refined but approachable look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance care\u003c\/strong\u003e: simple wipe-clean care and careful storage keep the pearls lustrous over time.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003ePerfect for whom\u003c\/h2\u003e\n\u003cp\u003eIdeal for brides seeking a romantic, nature-inspired touch, bridesmaids, or anyone who loves a modern, feminine accessory with timeless appeal. Great as a thoughtful gift for birthdays, anniversaries, or a special milestone.\u003c\/p\u003e \u003ch2\u003eHow to wear and care\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eWear with outfits that show off the neckline—collared shirts for a classic vibe, or off-the-shoulder looks for a soft focal point.\u003c\/li\u003e \u003cli\u003eAvoid contact with harsh chemicals and store in a soft pouch when not in use.\u003c\/li\u003e \u003cli\u003eGently wipe pearls with a soft, damp cloth after wearing to remove oils and fingerprints.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eEnhance your jewelry collection with a touch of garden-inspired elegance. Add the Fresh Water Pearl Blossom Cluster Drop Studs to your cart and experience a refined, feminine glow that lasts from day to night.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Gold","offer_id":56936607514999,"sku":"SKU_1772806823450_400","price":21.48,"currency_code":"EUR","in_stock":true},{"title":"Silver","offer_id":56936607547767,"sku":"SKU_1772806823450_371","price":21.48,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/il_fullxfull.7160108740_71un.jpg?v=1774538208"},{"product_id":"10mm-mixed-color-abalone-shell-bead-necklace-for-women-vintage-tribal-style-luxurious-pearl-gemstone-accents-perfect-for-daily-wear-gifting-all-season-versatile-accessory-everyday-jewelryvintageinspired-necklacedurable-necklace","title":"Midnight Pearl Strand Necklace","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eMidnight Pearl Strand Necklace\u003c\/strong\u003e is a refined expression of quiet glamour. Built around a single, uninterrupted line of pearls, it exudes a sophisticated glow that catches the eye without shouting for attention. The result is a versatile piece that elevates both everyday elegance and formal allure.\u003c\/p\u003e \u003cp\u003eDesigned for real-world moments, this necklace pairs gracefully with a range of outfits—from a tailored blazer and pencil skirt to a flowing evening gown. Its timeless silhouette flatters the neckline, creating a balanced focal point that complements skin tones and adds a touch of luxe to any complexion.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy this necklace stands apart\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eMonochrome midnight allure:\u003c\/strong\u003e pearls with a deep, dusk-toned luster that reads as both mysterious and refined.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility:\u003c\/strong\u003e transitions from day to night with ease, making it an instantly polished upgrade for many looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless silhouette:\u003c\/strong\u003e a classic strand that remains timeless across trends and seasons.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eIdeal for:\u003c\/strong\u003e special occasions like weddings, galas, and milestone events, as a standout accessory for bridesmaids, or as a thoughtful, enduring gift for someone who cherishes understated luxury. It also serves as a reliable finishing touch for professionals who want a refined, confident appearance without overpowering their outfit.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003ePractical styling tips\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003ePair with metallic or jewel-tone attire to let the midnight pearls emerge with radiance.\u003c\/li\u003e \u003cli\u003eLet it be the anchor piece for an otherwise minimalist ensemble—add a pair of simple stud earrings to complete the look.\u003c\/li\u003e \u003cli\u003eStore it in a soft, breathable pouch away from direct light and harsh chemicals to preserve its luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eEnhance your jewelry collection with a piece that speaks in a soft, luminous whisper. The \u003cstrong\u003eMidnight Pearl Strand Necklace\u003c\/strong\u003e isn’t just an accessory—it’s a statement of timeless elegance that you’ll reach for again and again.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936607416695,"sku":"SKU_1772561622482_308","price":43.01,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_ef7c4679-5a13-4ad7-b51b-8c0c159f7bdc.jpg?v=1774538209"},{"product_id":"vintage-engagement-ring-golden-color-rings-leaf-wedding-ring-art-deco-leaf-floral-ring-promise-rings-for-women","title":"Fresh Water Pearl Blossom Vine Band Ring","description":"\u003cdiv\u003e\n\u003cp\u003eImmerse yourself in botanical elegance with the Fresh Water Pearl Blossom Vine Band Ring. This piece fuses the soft radiance of a freshwater pearl with a delicate, vine-inspired silhouette that elegantly blooms around the finger.\u003c\/p\u003e \u003cp\u003eAt its heart lies a single freshwater pearl, prized for its gentle luster and flawless, satin-like sheen. Surrounding the pearl, intricate vine-and-blossom metalwork winds into the band, creating a wearable sculpture that catches light from every angle and adds a touch of nature-driven charm to any ensemble.\u003c\/p\u003e \u003ch3\u003eWhy this ring stands out\u003c\/h3\u003e\n\u003cp\u003eThis isn’t just a pearl on a ring—it's a nature-inspired statement designed for everyday wear and special occasions alike. The Blossom Vine motif offers a unique, eye-catching twist on classic pearl jewelry, pairing beautifully with casual outfits or elevating a formal look. The design emphasizes comfort with a smooth inner surface and a balanced band that sits gracefully on the finger.\u003c\/p\u003e \u003cul\u003e\n\u003cli\u003eFreshwater pearl centerpiece with a soft, iridescent glow\u003c\/li\u003e\n\u003cli\u003eNature-inspired vine and blossom silhouette for a distinctive, botanical look\u003c\/li\u003e\n\u003cli\u003eVersatile styling: transitions seamlessly from day to night\u003c\/li\u003e\n\u003cli\u003eIdeal gift for birthdays, anniversaries, or Mother’s Day\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWho this is ideal for: pearl enthusiasts seeking a delicate, nature-themed piece; anyone drawn to jewelry that blends classic pearl elegance with botanical artistry; brides or bridesmaids wanting a subtle bloom motif to complement wedding attire.\u003c\/p\u003e \u003cp\u003eCare tips: To maintain the pearl’s luster, wipe gently with a soft cloth after wear, avoid contact with harsh chemicals, and store separately from other jewelry to prevent scratches. When not in use, keep it in a soft pouch or jewelry box to preserve the pearl’s glow.\u003c\/p\u003e \u003cp\u003eRefresh your jewelry collection with a ring that beautifully marries timeless pearl brilliance with botanical charm. Add the Fresh Water Pearl Blossom Vine Band Ring to your cart today and wear a piece that feels both timeless and uniquely you.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Silver \/ 5","offer_id":56936607580535,"sku":null,"price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 6","offer_id":56936607613303,"sku":"SKU_1772744049505_814","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 7","offer_id":56936607646071,"sku":"SKU_1772744049505_770","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 8","offer_id":56936607678839,"sku":"SKU_1772744049505_262","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 9","offer_id":56936607711607,"sku":"SKU_1772744049505_620","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 10","offer_id":56936607744375,"sku":"SKU_1772744049505_849","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 11","offer_id":56936607777143,"sku":"SKU_1772744049505_329","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Silver \/ 12","offer_id":56936607809911,"sku":"SKU_1772744049505_934","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 5","offer_id":56936607842679,"sku":null,"price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 6","offer_id":56936607875447,"sku":"SKU_1772744049505_905","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 7","offer_id":56936607908215,"sku":"SKU_1772744049505_817","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 8","offer_id":56936607940983,"sku":"SKU_1772744049505_623","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 9","offer_id":56936607973751,"sku":"SKU_1772744049505_578","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 10","offer_id":56936608006519,"sku":"SKU_1772744049505_129","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 11","offer_id":56936608039287,"sku":"SKU_1772744049505_612","price":29.23,"currency_code":"EUR","in_stock":true},{"title":"Golden \/ 12","offer_id":56936608072055,"sku":"SKU_1772744049505_628","price":29.23,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Silver_ring_with_202604221718.jpg?v=1776874740"},{"product_id":"1-pair-of-luxury-womens-earrings-with-full-artificial-artificial-perfect-as-a-daily-or-festival-gift-suitable-for-yearound-wear","title":"Pearl Drop Statement Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Drop Statement Stud Earrings\u003c\/strong\u003e deliver a timeless pearl allure with a contemporary silhouette, making them a go-to choice for everything from polished workwear to elegant evening looks.\u003c\/p\u003e \u003cp\u003eWhat makes this pair distinctive is the way the classic pearl drop is married to a compact stud base, creating a design that sits close to the ear while catching light with each movement. The result is a versatile accessory that reads as sophisticated without feeling fussy, so you can wear it from boardroom meetings to after-hours events with equal ease.\u003c\/p\u003e \u003cp\u003eWho should consider them? Anyone seeking a single pair of earrings that can anchor a wide range of outfits—bridal guests seeking a touch of romance, anniversary dinners, or anyone who loves refined, everyday luxury. They pair beautifully with other pearl pieces for a coordinated look, or stand alone to let the pearl take center stage.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless pearl appeal:\u003c\/strong\u003e a graceful drop that adds depth and dimension to your ears\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCompact stud base\u003c\/strong\u003e with a hint of drama from the drop for versatile styling\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTransitional design:\u003c\/strong\u003e effortless from day to night, office to soirée\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIdeal gift idea:\u003c\/strong\u003e birthdays, anniversaries, or bridesmaid moments\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eCare tip: to keep the luster bright, wipe with a soft cloth after wear and store in a dry, cool place away from sharp objects.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936608563575,"sku":"SKU_1772563600458_103","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_6d75bd93-ccf9-4912-afdc-3646d913bc26.jpg?v=1774538215"},{"product_id":"a-pair-of-elegant-and-classic-drop-earrings-for-women-featuring-water-drop-shaped-faux-pearl-pendants-perfect-for-vacations-parties-weddings-engagements-and-bridal-wear","title":"Teardrop Pearl Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eExperience the quiet luxury of Teardrop Pearl Drop Earrings, where timeless pearl glow meets a sleek, contemporary silhouette. Each earring features a refined teardrop pearl that catches the light with every movement, suspended from a slim setting designed for secure, all‑day comfort.\u003c\/p\u003e \u003ch3\u003e Why these stand out \u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eElegant teardrop silhouette that elongates the neck and adds subtle drama to day or night looks.\u003c\/li\u003e \u003cli\u003eLustrous pearls with natural iridescence that shift with your surroundings, elevating anything from a blazer to a formal gown.\u003c\/li\u003e \u003cli\u003eThoughtful craftsmanship that balances a delicate drop with a reliable, comfortable fit you can wear all day or night.\u003c\/li\u003e \u003cli\u003eVersatile enough for multiple occasions—bridal parties, date nights, corporate events, or simply upgrading your everyday style.\u003c\/li\u003e \u003cli\u003eBeautifully giftable for anniversaries, birthdays, or special milestones—an enduring addition to any pearl jewelry collection.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho it's for\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eAnyone who loves the timeless charm of pearls with a modern twist.\u003c\/li\u003e \u003cli\u003eBrides, bridesmaids, and wedding guests looking for a pair of earrings that pairs with a range of gowns.\u003c\/li\u003e \u003cli\u003eProfessionals seeking a polished accessory that transitions seamlessly from desk to after-hours.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eProtect the luster: wipe gently with a soft cloth after wear and store in a jewelry pouch to prevent scratches.\u003c\/li\u003e \u003cli\u003eAvoid contact with harsh chemicals, perfumes, and hairsprays to preserve the pearl’s natural shine.\u003c\/li\u003e \u003cli\u003eClean sparingly; pearls appreciate a gentle touch and regular, careful handling.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003ePractical tips\u003c\/h3\u003e\n\u003cp\u003ePair these Teardrop Pearl Drop Earrings with a satin blouse for a refined office-to-evening transition, or with a flowing bridesmaid dress for a timeless bridal look. If you’re styling for a formal event, let the earrings be the centerpiece—keep other jewelry minimal to let the teardrop pearls take the spotlight.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936608596343,"sku":"SKU_1772743918335_967","price":33.54,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/2_3ef5d5ab-01ca-4aee-ae6e-4ee321610eb5.png?v=1774538216"},{"product_id":"a-pair-of-long-elegant-french-niche-designs-with-a-high-end-feel-ear-hooks-womens-korean-temperament-cold-and-cool-style-earrings-and-fashionable-womens-earrings-wedding-season-wedding","title":"Twist Loop Pearl Drop Earrings","description":"\u003cdiv\u003eTwist Loop Pearl Drop Earrings fuse timeless pearl allure with a sleek, contemporary silhouette—the kind of accessory that moves from desk to dinner with effortless grace. The key feature, a refined twist loop fastening, locks the earring securely in place while maintaining a streamlined, minimalist profile that won’t snag on scarves or collars. The luminous pearl drop delivers a subtle radiance that catches light from every angle, ensuring you never blend into the background. \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTwist loop fastening\u003c\/strong\u003e for secure, easy wear that stays put as you go about your day.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl drop\u003c\/strong\u003e with natural luminosity adds a touch of classic elegance to any look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLightweight construction\u003c\/strong\u003e combines a slim loop with a pearl drop for comfortable all‑day wear.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e pairs beautifully with professional attire, evening ensembles, or wedding guest outfits.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance care\u003c\/strong\u003e simple cleaning helps preserve the pearl’s glow and the metal’s sheen.\u003c\/li\u003e\n\u003c\/ul\u003e Twist Loop Pearl Drop Earrings are ideal for anyone who values a refined, understated statement. They suit professionals aiming to elevate a blazer-and-blouse outfit, nightlife looks that need a touch of sophistication, or special occasions where photography loves a piece with graceful movement. The combination of a timeless pearl with a modern loop design creates a piece that feels both familiar and refreshingly current. Care tips to keep them looking their best: wipe with a soft, dry cloth after wear, store away from direct sunlight, and avoid harsh chemicals or cosmetics contacting the pearl to maintain its natural luster over time. Embrace a look that’s polished without shouting. Add the Twist Loop Pearl Drop Earrings to your collection and let their quiet glow complement every moment from morning meetings to milestone celebrations.\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936608694647,"sku":"SKU_1772560972048_100","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/6315e803-340d-4bc2-8d00-ed7c76f1035e.jpg?v=1774538215"},{"product_id":"elegant-oval-teardrop-pendant-earrings-alloy-bridal-jewelry-for-parties-valentines-day-gift-all-season-wear-wedding-gifts","title":"Teardrop Pearl Crystal Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate every moment with the Teardrop Pearl Crystal Drop Earrings—a refined blend of luminous pearls and radiant crystals housed in a graceful teardrop silhouette. Designed to catch light from every angle, these earrings add a sophisticated glow to both everyday looks and special occasions.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eElegant teardrop design:\u003c\/strong\u003e A timeless silhouette that frames the face while the pearl centerpiece and crystal facets shimmer with movement, creating a subtle, daytime-to-evening transition.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile for any occasion:\u003c\/strong\u003e Perfect for weddings, cocktail parties, anniversaries, date nights, or elevating a polished office ensemble with a touch of refined glamour.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl and crystal harmony:\u003c\/strong\u003e The combination delivers a balanced sparkle—quietly luxe enough for close-up details and dazzling from a distance.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEasy to care for:\u003c\/strong\u003e Gentle cleaning and proper storage help preserve the pearl luster and crystal brilliance over time.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThese Teardrop Pearl Crystal Drop Earrings are an ideal gift for someone who cherishes classic jewelry with a contemporary twist, or for anyone building a versatile accessory collection that transitions from day to night with ease. Whether you’re dressing for a wedding, a milestone celebration, or adding a sophisticated finish to casual chic, this pair delivers understated elegance with every sway.\u003c\/p\u003e \u003cp\u003eKey details at a glance: teardrop silhouette, pearl focal point, crystal accents, and a look that pairs beautifully with neutrals, metallics, and rich fabrics. Ready to enhance your jewelry drawer with a piece that combines timeless charm and modern sparkle.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936608661879,"sku":"SKU_1772641483625_635","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/2_a882c640-a7df-4c8b-baa1-542d394070ef.jpg?v=1774538216"},{"product_id":"natural-freshwater-pearl-ring-for-women-adjustable-opening-design-retro-enamel-floral-multi-color-index-finger-ring-new-chinese-style-mothers-day-valentines-day-gift","title":"Pearl Petal Twist Open Adjustable Ring","description":"\u003cdiv\u003e\n\u003cp\u003eThe Pearl Petal Twist Open Adjustable Ring brings a whisper of romance to any look. A luminous pearl sits at the heart of a delicate, petal-inspired band, while an open back provides a comfortable, adjustable fit that adapts to your finger with ease. This ring isn’t just pretty—it’s designed for real-life moments, from daily errands to special evenings, without sacrificing wearability.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece\u003c\/strong\u003e: A single, iridescent pearl takes center stage, catching light from every angle and adding a soft, sophisticated glow to your style.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePetal twist design\u003c\/strong\u003e: The band curls into a graceful petal silhouette, creating a feminine, contemporary look that stands out in a crowd of plain bands.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eOpen adjustable fit\u003c\/strong\u003e: An open shank allows gentle sizing tweaks, so you can wear it comfortably across different days, outfits, and occasions.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: Slim enough for everyday wear yet refined for date nights or celebrations—perfect for layering with other rings for a curated, modern stack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eIdeal gift with meaning\u003c\/strong\u003e: A thoughtful choice for birthdays, anniversaries, or “just because”—a timeless piece that communicates understated elegance.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: Preserve its glow by removing it when swimming or cleaning, and wipe with a soft cloth after wear to keep the pearl and finish looking pristine.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eElevate your jewelry collection with a ring that blends classic pearl serenity with a contemporary twist. The Pearl Petal Twist Open Adjustable Ring is the subtle statement you’ll reach for again and again.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936608891255,"sku":"SKU_1772560408831_781","price":27.51,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/f2148b3f-b6e6-4a35-948c-044070932d3e.jpg?v=1774538222"},{"product_id":"retro-five-petal-flower-cluster-inlaid-faux-pearl-single-ring","title":"Floral Filigree Moonstone Dome Ring","description":"\u003cdiv\u003e\n\u003cp\u003eFloral Filigree Moonstone Dome Ring is where luminous beauty meets timeless craftsmanship. This ring centers a luminous moonstone beneath a softly domed bezel, all framed by an intricate floral filigree that recalls vintage botanical lace. It’s more than an accessory—it’s a wearable moment of light and romance you can carry with you.\u003c\/p\u003e \u003ch3\u003eWhy this moonstone ring stands out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eMoonstone brilliance\u003c\/strong\u003e: Moonstone’s adularescence creates a delicate blue-white sheen that shifts with your perspective, ensuring no two stones look the same. Your ring will reveal a unique glow in sunlit hours and softly muted tones in evening light.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eDome setting with timeless appeal\u003c\/strong\u003e: The gently domed bezel centers the gemstone and adds a bold, sculpted silhouette that catches attention from every angle while providing a secure, durable mount.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eFloral filigree craft\u003c\/strong\u003e: Delicate petal and leaf motifs weave a lightweight, openwork halo around the stone, giving the piece a vintage-inspired charm that remains perfectly relevant in modern wardrobes.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eAll-day versatility\u003c\/strong\u003e: A graceful profile and comfortable finish make it easy to wear solo for a quiet statement or alongside other rings for a curated stack.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho it’s for\u003c\/h3\u003e\n\u003cp\u003eIdeal for moonstone lovers and fans of botanical design, this ring suits anyone seeking a luminous centerpiece with antique-inspired flair. It’s a thoughtful gift for birthdays, anniversaries, or milestones, and it transitions seamlessly from casual days to special occasions.\u003c\/p\u003e \u003ch3\u003eStyle and pairing ideas\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePair with other silver-tinted jewelry or soft neutrals to let the moonstone’s glow take center stage.\u003c\/li\u003e \u003cli\u003eLayer with slim bands in varying textures for a modern, dimensional look.\u003c\/li\u003e \u003cli\u003eLet the floral filigree echo in a delicate bracelet or necklace to create a cohesive, vintage-inspired set.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo keep the moonstone’s adularescence shining, clean with a mild soap and warm water, then pat dry with a soft cloth. Avoid harsh chemicals and ultrasonic cleaners. When not wearing it, store in a soft pouch or lined jewelry box to protect the delicate filigree details from scratches.\u003c\/p\u003e \u003cp\u003eElevate your everyday with the Floral Filigree Moonstone Dome Ring—a piece that blends iridescent charm with intricate artistry for a look that’s distinctly yours. Add to cart and wear a touch of moonlit enchantment today.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"5","offer_id":56936608924023,"sku":null,"price":30.95,"currency_code":"EUR","in_stock":true},{"title":"6","offer_id":56936608956791,"sku":"SKU_1772560622862_442","price":30.95,"currency_code":"EUR","in_stock":true},{"title":"7","offer_id":56936608989559,"sku":"SKU_1772560622862_717","price":30.95,"currency_code":"EUR","in_stock":true},{"title":"8","offer_id":56936609022327,"sku":"SKU_1772560622862_1","price":30.95,"currency_code":"EUR","in_stock":true},{"title":"9","offer_id":56936609055095,"sku":"SKU_1772560622862_105","price":30.95,"currency_code":"EUR","in_stock":true},{"title":"10","offer_id":56936609087863,"sku":"SKU_1772560622862_147","price":30.95,"currency_code":"EUR","in_stock":true},{"title":"11","offer_id":56936609120631,"sku":"SKU_1772560622862_865","price":30.95,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/The_Porduct_is_placed_flat_202605041521.jpg?v=1777904505"},{"product_id":"udsogt-hvid-perlehalskaede","title":"Exquisite White Pearl Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Exquisite White Pearl Necklace, a timeless piece designed to elevate any look with quiet, luminous elegance. This necklace showcases a strand of pristine white pearls that catch the light with a natural glow, creating a refined silhouette that suits both formal events and everyday sophistication.\u003c\/p\u003e \u003cp\u003eDesigned for versatility, this pearl necklace transitions effortlessly from a refined office ensemble to an evening gown, making it a dependable go-to accessory when you want to add a touch of luxury without overpowering your outfit. The classic strand shape flatters a variety of necklines, from plunging necklines to crew necks, providing a clean, balanced line that draws attention where you want it most.\u003c\/p\u003e \u003ch3\u003eWhy this Exquisite White Pearl Necklace stands out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless radiance:\u003c\/strong\u003e lustrous white pearls with a consistent glow that enhances any skin tone.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless versatility:\u003c\/strong\u003e pairs beautifully with both professional attire and formal eveningwear, helping you look put-together in any setting.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eBalanced, flattering silhouette:\u003c\/strong\u003e the strand drapes gracefully to create a refined neckline that complements a wide range of outfits.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSecure wear:\u003c\/strong\u003e designed with a reliable closure to keep the necklace in place from desk to dance floor.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eIdeal for gifting and for anyone who appreciates classic jewelry with a modern sensibility, this necklace brings a sense of grace to milestones and everyday moments alike. It’s the perfect companion for weddings, anniversaries, graduations, or simply elevating your day-to-day wardrobe with a signature piece that never goes out of style.\u003c\/p\u003e \u003ch3\u003eStyling ideas and practical tips\u003c\/h3\u003e\n\u003cp\u003eKeep the look understated for a chic, minimalist effect by pairing the Exquisite White Pearl Necklace with a black dress or a crisp white blouse. For a bolder statement, layer it with delicate chains or stack it with other pearl pieces for texture and depth. When attending events, let the pearls take center stage and avoid overpowering them with heavy necklaces or large earrings.\u003c\/p\u003e \u003ch3\u003eCare and maintenance\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eWipe gently with a soft, damp cloth after wear to remove oils and residues.\u003c\/li\u003e \u003cli\u003eStore separately in a soft pouch to prevent scratches and tangling with other jewelry.\u003c\/li\u003e \u003cli\u003eAvoid contact with perfumes, hairsprays, and household cleaners, which can dull luster over time.\u003c\/li\u003e \u003cli\u003eHave pearls restrung or inspected if you notice loose beads or changes in drape.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWith its enduring elegance and adaptable styling, the Exquisite White Pearl Necklace is more than an accessory—it’s a reliable companion for every facet of life that calls for a touch of refined brilliance. \u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936609415543,"sku":"SKU_1772309140296_59","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/image-2023-12-04T133258.402_1800x1800_6d43c21f-a61b-4d4a-89c3-70ea25d508e0.webp?v=1775517060"},{"product_id":"vintage-style-finger-ring-inlaid-faux-pearls-boho-finger-rings-for-women-party-jewlery","title":"Classic Silver Orbit Pearl Ring","description":"\u003cdiv\u003e\n\u003cp\u003eThe Classic Silver Orbit Pearl Ring blends a luminous pearl with a delicate orbit of polished silver, delivering a look that’s effortlessly sophisticated and distinctly modern. This is the kind of piece that elevates daily outfits and adds a touch of celestial elegance to special occasions alike.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eStriking centerpiece\u003c\/strong\u003e — A single, lustrous pearl anchors the design, drawing the eye with timeless iridescence and natural character that ages beautifully with wear.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eContemporary orbit setting\u003c\/strong\u003e — A slim, sculpted arc of sterling silver wraps the pearl, creating a negative-space silhouette that feels airy, refined, and uniquely yours.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfort-first design\u003c\/strong\u003e — A streamlined band and smooth interior ensure easy wearing from morning meetings to evening outings, without sacrificing presence.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e — The Classic Silver Orbit Pearl Ring pairs beautifully with other jewelry, from minimalist stackables to a single statement pendant, making it a flexible choice for every wardrobe.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMeaningful gift option\u003c\/strong\u003e — Perfect for anniversaries, birthdays, or “just because,” this ring communicates understated romance and a taste for enduring design.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare and longevity\u003c\/strong\u003e — To maintain its luster, wipe with a soft cloth after wear, avoid harsh chemicals, and store separately from other jewelry to prevent scratches.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eDesigned for those who appreciate refined simplicity, the Classic Silver Orbit Pearl Ring offers a signature look without overpowering your style. It’s an ideal choice when you want a jewelry piece that feels both timeless and intimately modern—a ring you’ll reach for again and again, season after season.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"5","offer_id":56936609481079,"sku":null,"price":34.4,"currency_code":"EUR","in_stock":true},{"title":"6","offer_id":56936609513847,"sku":"SKU_1772127721073_919","price":34.4,"currency_code":"EUR","in_stock":true},{"title":"7","offer_id":56936609546615,"sku":"SKU_1772127721073_556","price":34.4,"currency_code":"EUR","in_stock":true},{"title":"8","offer_id":56936609579383,"sku":"SKU_1772127721073_489","price":34.4,"currency_code":"EUR","in_stock":true},{"title":"9","offer_id":56936609612151,"sku":"SKU_1772127721073_666","price":34.4,"currency_code":"EUR","in_stock":true},{"title":"10","offer_id":56936609644919,"sku":"SKU_1772127721073_480","price":34.4,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/S6113b0744fca4198a498c3bbb5d3af3eT.webp?v=1774538229"},{"product_id":"vintage-pearl-bracelets-pack","title":"Vintage Pearl Bracelets Pack","description":"\u003cdiv\u003e\n\u003cp\u003eTimeless charm meets modern versatility with the Vintage Pearl Bracelets Pack—a carefully curated set of pearl-inspired bracelets designed to elevate every moment, from casual weekends to polished evenings. Each piece glows with a soft, retro luster that captures the essence of vintage jewelry while remaining effortless to wear in today’s wardrobe.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e wear a single bracelet for a clean, understated touch, or stack multiple pieces for a statement-making look that transitions from day to night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCoordinated variety:\u003c\/strong\u003e a mix of sizes and subtle metallic accents to complement everything from crisp office wear to a flowing dress, making it easy to create multiple outfits with one pack.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfort-first design:\u003c\/strong\u003e lightweight beadwork on durable stringing with smooth finishes ensures comfortable all-day wear, even for extended events.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready appeal:\u003c\/strong\u003e a thoughtful, ready-to-gift set that suits birthdays, anniversaries, bridesmaids, weddings, or simply treating someone special to timeless style.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eCare for longevity:\u003c\/strong\u003e gentle wipe with a soft cloth after wear and avoidance of harsh chemicals help preserve the pearl-like sheen and luster.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eWho this is for\u003c\/h3\u003e\n\u003cp\u003eIdeal for jewelry lovers who crave a touch of nostalgia without sacrificing wearability. Great for brides and bridal parties, moms and sisters, or anyone building a versatile jewelry rotation that can be dressed up or down.\u003c\/p\u003e \u003ch3\u003eWhy it stands out\u003c\/h3\u003e\n\u003cp\u003eThis Vintage Pearl Bracelets Pack stands apart with its thoughtfully curated mix that channels vintage glamour while staying adaptable to contemporary outfits. It offers the breadth of a multi-piece set without the clutter of purchasing individual pieces, delivering variety, value, and ease in one elegant package.\u003c\/p\u003e \u003ch3\u003eStyle tips and use cases\u003c\/h3\u003e\n\u003cp\u003eFor a refined daytime look, pair a single pearl-inspired bracelet with a crisp blouse and tailored blazer. For evening glamour, layer a few pieces with slim metallic accents to enhance the pearl glow. Use the pack to create different moods—soft and graceful for weddings, sleek and modern for work, playful layering for weekend casual.\u003c\/p\u003e \u003ch3\u003eCare and storage\u003c\/h3\u003e\n\u003cp\u003eStore in a soft jewelry pouch or lined box to prevent tangling and scratches. After wearing, wipe gently with a soft cloth, and keep away from water, perfumes, and lotions to protect the delicate sheen.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936609448311,"sku":"SKU_1772476201031_470","price":33.54,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/image_-_2024-07-31T103049.262.png?v=1774538230"},{"product_id":"2026-new-zircon-inlaid-pearl-opening-rings-fashion-jewelry-for-young-girls-wedding-party-luxury-accessories-for-womens-rings","title":"Vintage Adjustable Pearl Zirconia Ring","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Vintage Adjustable Pearl Zirconia Ring—where classic charm meets contemporary wearability. A luminous pearl anchors the design, embraced by a halo of gleaming zirconia, all wrapped in a vintage-inspired silhouette. The real innovation lies in the adjustable band, designed to fit a range of finger sizes with a comfortable, secure feel so you can wear this piece from day to night and across seasons.\u003c\/p\u003e \u003ch2\u003eWhy this ring stands out\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eAdjustable comfort, versatile wear\u003c\/strong\u003e: The band adapts to multiple sizes, removing the guesswork of sizing and letting you wear it across different fingers or share it with someone who wears a similar size.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003ePearl centerpiece with a Zirconia halo\u003c\/strong\u003e: A polished pearl takes center stage, while sparkling zirconia accents add just the right amount of shimmer to elevate any look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless vintage-inspired design\u003c\/strong\u003e: Classic lines and a refined silhouette make this ring a graceful companion for both everyday outfits and special occasions.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle statement for any occasion\u003c\/strong\u003e: Ideal for weddings, anniversaries, date nights, or as a refined everyday accent that never overwhelms your overall style.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eWho this is for\u003c\/h2\u003e\n\u003cp\u003eThis ring is perfect for lovers of understated elegance who want a piece that grows with them. It suits bridesmaids, anniversary gifts, or a thoughtful present for anyone who appreciates a timeless blend of pearl and sparkle in a single, versatile accessory.\u003c\/p\u003e \u003ch2\u003eHow it solves common needs\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eVariable sizing in one piece\u003c\/strong\u003e: An adjustable band ensures a comfortable fit without the need to reorder different sizes.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday luxury with evening polish\u003c\/strong\u003e: The pearl and zirconia pairing elevates casual outfits and complements formal wear alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLow-maintenance elegance\u003c\/strong\u003e: A durable, classic design that stays stylish over time, reducing the need for frequent updates to your jewelry box.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eCare and maintenance\u003c\/h2\u003e\n\u003cp\u003eKeep the luster shining: remove the ring before swimming or showering, avoid contact with harsh chemicals, and wipe the pearl and zirconia with a soft, lint-free cloth after wear. Store separately in a jewelry box or pouch to prevent scratches and preserve the pearl’s natural sheen.\u003c\/p\u003e \u003ch2\u003eSize and adjustment tips\u003c\/h2\u003e\n\u003cp\u003eTo adjust, gently widen or compress the band until you locate a comfortable, secure fit. The design accommodates micro-adjustments, so you can dial in the exact size you prefer. If you’re unsure about sizing, start with a slightly looser setting and refine after a few days of wear.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Gold","offer_id":56936609710455,"sku":"SKU_1772296098208_776","price":30.95,"currency_code":"EUR","in_stock":true},{"title":"White Gold","offer_id":56936609743223,"sku":null,"price":30.95,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/S8e85044b74b94021a2cb08bef5210aa3j.webp?v=1774538230"},{"product_id":"stainless-steel-temperament-pearl-chain-choker-necklace-for-women-waterproof-collar-jewelry-bijoux-gift","title":"Pearl Chain Choker Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eMeet the Pearl Chain Choker Necklace—a modern refinement of a timeless icon. A delicate chain suspends a luminous row of pearls, delivering a soft glow that enhances any ensemble.\u003c\/p\u003e \u003cp\u003eWhat makes it special:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003ePearl-forward elegance\u003c\/strong\u003e paired with a slender chain for a clean, contemporary aesthetic.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e—wear it alone for a minimalist statement or layer with longer pieces to create texture and depth.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday to occasion-ready\u003c\/strong\u003e—works with office blouses, knitwear, satin dresses, or chic evening looks.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-worthy\u003c\/strong\u003e—a thoughtful present for birthdays, anniversaries, or brides-to-be.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003ePractical uses and pairing ideas:\u003c\/p\u003e\n\u003cul\u003e \u003cli\u003ePair with V-neck or off-the-shoulder tops to frame the pearls and draw the eye toward the neckline.\u003c\/li\u003e \u003cli\u003eCombine with a delicate pendant necklace for a layered look that remains balanced and elegant.\u003c\/li\u003e \u003cli\u003eChoose this piece as a bridal accessory for a timeless, subtle shimmer on your special day.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eCare and maintenance: After wearing, wipe with a soft, dry cloth and store separately from other jewelry to prevent tangling. Avoid contact with perfumes and lotions to preserve the pearls’ luster.\u003c\/p\u003e \u003cp\u003eSize and fit notes: Designed to sit close to the neck with a streamlined profile that complements a variety of necklines. The necklace is easy to slip on and off for quick styling tweaks throughout the day.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610136439,"sku":"SKU_1772744179515_721","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/The_Porduct_is_placed_flat_202605041512.jpg?v=1777904078"},{"product_id":"helena-inspired-classic-pearl-earrings","title":"Classic Pearl Helena Earrings","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eClassic Pearl Helena Earrings\u003c\/strong\u003e blend timeless pearl elegance with a modern, fluid silhouette. Smooth teardrop pearls dangle from slim, softly curved hooks, creating a graceful line that feels effortless as you move.\u003c\/p\u003e \u003cp\u003eThe design plays with a gentle contrast: luminous white pearls set against warm-toned metal. It’s a refined look that’s noticeable without shouting, making these earrings a versatile choice for daily wear and special occasions alike.\u003c\/p\u003e \u003ch3\u003eWhy they stand out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eFluid, minimalist aesthetic:\u003c\/strong\u003e a clean, uninterrupted drop that complements any neckline or hairstyle.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfortable movement:\u003c\/strong\u003e the slim hooks flow with you, reducing tugging and staying comfortably secure from desk to dinner.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eSubtle warmth, radiant pearlescence:\u003c\/strong\u003e the warm metal hues highlight the pearls’ glow, creating a sophisticated, flattering balance on a range of skin tones.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e elevates everyday outfits—knits, blouses, and tailored looks—without feeling overdone, while also pairing elegantly with more formal ensembles.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003ePerfect for these moments\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eEveryday refinement at the office or during weekend outings\u003c\/li\u003e \u003cli\u003eSmart styling for date nights or special events where you want a touch of understated glamour\u003c\/li\u003e \u003cli\u003eA thoughtful, timeless gift for someone who appreciates classic pearls with a contemporary edge\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo keep the pearls and metal looking their best, wipe gently with a soft microfiber cloth after wear and store in a protective pouch. Avoid direct contact with perfumes, lotions, and harsh chemicals, which can dull the pearl’s luster over time.\u003c\/p\u003e \u003cp\u003eExperience the quiet sophistication of the Classic Pearl Helena Earrings—where a simple drop becomes a signature detail. \u003cstrong\u003eAdd to cart\u003c\/strong\u003e to elevate your everyday looks with a touch of timeless refinement.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610070903,"sku":null,"price":23.2,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/2_cdce409c-08ec-4003-9731-a47deb1c7508.jpg?v=1774538237"},{"product_id":"graceful-pearl-dangling-earrings","title":"Elegant Pearl Dangling Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate every moment with the Elegant Pearl Dangling Earrings—a refined piece of pearl drop earrings that feels effortless from day to night. Smooth, round pearl-like accents hover from slender, softly curved hooks, delivering a light, graceful sway as you move. The result is a minimal, fluid silhouette that radiates quiet sophistication without shouting for attention.\u003c\/p\u003e \u003cp\u003eWhat sets these earrings apart:\u003c\/p\u003e \u003cul\u003e\n\u003cli\u003e\n\u003cstrong\u003ePearl-inspired elegance\u003c\/strong\u003e: round, smooth accents that catch the light with every turn of your head.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eSlim, curved hooks\u003c\/strong\u003e: designed for comfortable wear and a secure, everyday fit that won’t snag hair or clothing.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eFluid silhouette\u003c\/strong\u003e: gentle movement and clean lines that transition seamlessly from desk to dinner.\u003c\/li\u003e\n\u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: complements metallics, neutrals, or patterns, making them ideal for workwear, weekend outfits, and more formal occasions.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eThese earrings are crafted for those who appreciate understated luxury. They add a refined touch to your daily wardrobe and seamlessly elevate for dressier events without overpowering your look. Pair them with a crisp blouse for the office, a sleek dress for an evening out, or a blazer for a polished, cohesive ensemble.\u003c\/p\u003e \u003cp\u003eUse cases:\u003c\/p\u003e \u003cul\u003e\n\u003cli\u003eDaily wear at the office or during casual outings, bringing a subtle shimmer to any look.\u003c\/li\u003e\n\u003cli\u003eSmart-casual dinners and gatherings where a touch of elegance enhances your outfit.\u003c\/li\u003e\n\u003cli\u003eSpecial occasions where a minimal, pearl-inspired accent complements the overall attire.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWith their light, graceful movement and polished finish, these pearl drop earrings invite you to experience refined simplicity you can rely on day after day. Ready to add a timeless, versatile piece to your jewelry collection? Add them to your cart and let the effortless glow speak for your style.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610169207,"sku":null,"price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/3_a91e51d3-42bf-4799-88d8-fe7cb2b68d9e.jpg?v=1774538237"},{"product_id":"a-pair-of-vintage-elegant-minimalist-butterfly-knot-designed-faux-pearl-fashion-earrings-for-women-suitable-for-daily-wear-and-holidays","title":"Bow Halo Pearl Stud Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate everyday elegance with the Bow Halo Pearl Stud Earrings — a refined fusion of timeless pearls and a playful bow halo that catches the light from every angle. This thoughtful design isn’t just jewelry; it’s a subtle statement that complements everything from denim to evening gowns.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eCenterpiece:\u003c\/strong\u003e A lustrous cultured freshwater pearl sits at the heart of the earring, delivering classic sophistication with a modern, wearable edge.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eBow halo detail:\u003c\/strong\u003e A delicate bow-shaped halo surrounds the pearl, accented with tiny crystal pavé to create a soft, radiant glow.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eMaterials \u0026amp; finish:\u003c\/strong\u003e Nickel-free base metal with a polished silver-tone or warm gold-tone finish for lasting shine and skin-friendly comfort.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eComfort \u0026amp; security:\u003c\/strong\u003e Lightweight stud design paired with a secure push-back ensures day-to-night wear without irritation.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling:\u003c\/strong\u003e Perfect for workdays, weekend brunches, weddings, and everything in between — pair with a tailored blazer, a little black dress, or a casual tee to instantly elevate your look.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eGift-ready appeal:\u003c\/strong\u003e An ideal gift for anniversaries, birthdays, or “just because” moments — timeless enough to become a cherished keepsake.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eWhy choose Bow Halo Pearl Stud Earrings? They deliver a rare balance of classic pearl beauty and contemporary charm. The halo bow adds a touch of whimsy without overpowering the clean, elegant silhouette, making these earrings a flexible companion for any wardrobe. For a look that’s polished yet approachable, these pearl stud earrings are a flawless choice.\u003c\/p\u003e \u003cp\u003eCare tips: store in a soft pouch or jewelry box to avoid scratches, wipe gently with a soft cloth after wear, and keep away from harsh chemicals to preserve luster.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610234743,"sku":"SKU_1772641926519_405","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/Earrings_on_beige-gold_202604222041.jpg?v=1776886911"},{"product_id":"vintage-cross-triangle-pearl-dropping-earrings","title":"Vintage Cross Triangle Pearl Dropping Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eElevate every moment with the Vintage Cross Triangle Pearl Dropping Earrings — a refined fusion of timeless cross lines, geometric triangle framing, and a luminous pearl drop. Crafted with precision and high-quality materials, these earrings invite a level of quiet sophistication that lasts beyond trends.\u003c\/p\u003e \u003ch2\u003eSignature design that stands apart\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eDistinctive cross and triangle silhouette: a vintage-inspired motif reimagined for modern wear, offering a subtle storytelling element to any look.\u003c\/li\u003e \u003cli\u003eDelicate pearl drop: a radiant focal point that catches the light with every move, adding a touch of understated glamour.\u003c\/li\u003e \u003cli\u003eElegant yet versatile: pairs beautifully with everything from casual denim to tailored evening wear, ensuring you’re styled for any moment.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003eDesigned for lasting beauty and everyday wear\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eMeticulously crafted with durable construction to maintain shine and form through daily use and special occasions alike.\u003c\/li\u003e \u003cli\u003eLightweight enough for all-day wear, so you can transition from office meetings to after-hours with ease.\u003c\/li\u003e \u003cli\u003eTimeless aesthetics that remain relevant year after year, making them a reliable addition to your jewelry rotation.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch2\u003ePerfect for gifting or personal treasure\u003c\/h2\u003e\n\u003cp\u003eWhether you’re treating yourself or shopping for someone special, these pearl dropping earrings offer a thoughtful, enduring gift—ideal for anniversaries, birthdays, or just-because moments. Their classic appeal makes them a cherished keepsake that can be passed down through generations.\u003c\/p\u003e \u003ch2\u003eCare and longevity tips\u003c\/h2\u003e\n\u003cul\u003e \u003cli\u003eStore in a soft pouch or jewelry box to prevent scratches and tangling.\u003c\/li\u003e \u003cli\u003eAvoid contact with perfumes, lotions, and harsh chemicals to preserve the pearl’s luster.\u003c\/li\u003e \u003cli\u003eWipe gently with a soft cloth after wear and keep them dry to maintain their true shine over time.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eReady to add a touch of vintage charm to your jewelry collection? The Vintage Cross Triangle Pearl Dropping Earrings offer a refined, versatile statement that complements any wardrobe and elevates every occasion.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610103671,"sku":"SKU_1772308631995_842","price":25.79,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/cb918fd773c4f6441e57dfa13365c7e8.jpg?v=1774538236"},{"product_id":"multi-layer-shimmering-imitation-pearl-necklace-vibrant-bohemian-multilayer-necklace-shimmering-imitation-pearls-artisan-crafted-authentic-charm-a-feminine-exquisite-handmade-gift-for-ladies-unique-color-beads-randomly-arranged-in-every-piece","title":"Pearl Cascade Multi-Strand Bib Necklace","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003ePearl Cascade Multi-Strand Bib Necklace\u003c\/strong\u003e is a sculptural centerpiece designed to elevate any look with instant elegance. This statement piece features multiple strands that cascade across the chest, creating a luminous bib of pearl-toned drama that draws the eye and frames the neckline with refined sophistication.\u003c\/p\u003e \u003cp\u003eCrafted to transform everyday outfits into head-turning ensembles, the Pearl Cascade bib is ideal for formal events, wedding guests, gala dinners, and upscale evenings out. Its layered arrangement adds dimension and light-reflecting sheen, giving you a polished glow whether you’re wearing a sleek evening gown or a crisp blouse with a blazer.\u003c\/p\u003e \u003ch3\u003eWhy this necklace stands out\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eBold, multi-strand silhouette:\u003c\/strong\u003e more sculptural than a single-strand pearl, offering a contemporary, fashion-forward edge.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile focal point:\u003c\/strong\u003e complements necklines from off-the-shoulder and sweetheart to high necklines, and pairs beautifully with solid colors like black, navy, ivory, or jewel tones.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless chic:\u003c\/strong\u003e adds a touch of luxury without overpowering your entire look, making it perfect for both special occasions and elevated workwear.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eTimeless appeal:\u003c\/strong\u003e the pearl motif remains classic while the multi-strand design keeps it current for year-round wear.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eHow to wear it\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003ePair with an updo or swept-back hairstyle to showcase the full cascade and ensure the strands catch the light from every angle.\u003c\/li\u003e \u003cli\u003eWear over a solid-color gown or blouse to let the pearls stand out as the star of your ensemble.\u003c\/li\u003e \u003cli\u003eGreat with a little black dress for a timeless combination, or with soft neutrals to create a refined, modern look.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003eCare and longevity\u003c\/h3\u003e\n\u003cp\u003eTo keep the lustrous pearls gleaming, wipe after wear with a soft, dry cloth and store separately to prevent tangling or scratching. Avoid spraying perfume directly onto the pearls and keep away from sharp impact to preserve the necklace’s integrity over time.\u003c\/p\u003e \u003ch3\u003eDesigned for who will love it\u003c\/h3\u003e\n\u003cp\u003eThis necklace is ideal for anyone seeking a radiant, attention-worthy accessory that remains versatile across occasions. Perfect for brides seeking a touch of vintage-inspired glamour, guests attending formal weddings, or professionals looking to elevate a blazer and blouse combination without compromising on sophistication.\u003c\/p\u003e \u003cp\u003eElevate your jewelry collection with the Pearl Cascade Multi-Strand Bib Necklace and let its cascading pearls become the defining accent of your refined, fashion-forward style. Ready to make a striking entrance? Add it to your cart and transform your next look into a memorable moment.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610496887,"sku":"SKU_1772642216719_199","price":43.01,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_7b7926f7-94af-4091-bc94-19c3bea674f1.jpg?v=1774538243"},{"product_id":"a-pair-of-elegant-golden-cube-drop-earrings-bridal-jewelry-luxurious-and-fashionable-copper-jewelry-for-daily-wear-and-party-accessories-geometric-jewelry-2026","title":"Golden Cube Drop Earrings","description":"\u003cdiv\u003e\n\u003cp\u003eDiscover a modern classic with the \u003cstrong\u003eGolden Cube Drop Earrings\u003c\/strong\u003e. A crisp, geometric cube suspended on a delicate drop delivers a contemporary silhouette that catches the light from every angle, turning everyday moments into something distinctly stylish.\u003c\/p\u003e \u003cp\u003eThese earrings aren’t just accessories—they’re a versatile statement. The clean lines and warm gold-tone finish pair effortlessly with a suit for polished professional looks, a sleek blouse for polished weekday style, or a little black dress for after-hours elegance. They’re the kind of piece you reach for when you want a subtle yet unmistakable upgrade to your outfit.\u003c\/p\u003e \u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eGeometric centerpiece\u003c\/strong\u003e: a bright, architectural cube that adds contemporary edge to any ensemble.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eWarm gold-tone shine\u003c\/strong\u003e: rich, versatile hue that complements a wide range of skin tones and other metals.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eLight, balanced drop\u003c\/strong\u003e: designed to drape gracefully without overpowering your look, so you can wear them all day or night.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile styling\u003c\/strong\u003e: effortlessly transitions from desk to dinner, elevating casual outfits and formalwear alike.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEveryday luxury\u003c\/strong\u003e: crafted for comfortable wear and enduring appeal, making them a reliable go-to in your jewelry rotation.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho it’s for\u003c\/strong\u003e: perfect for anyone who loves clean lines and contemporary jewelry—minimalists who crave a distinctive geometric accent, trend-forward fashion lovers, and anyone searching for a thoughtful gift that feels personal yet modern.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and longevity\u003c\/strong\u003e: to maintain their radiant finish, wipe with a soft cloth after wear and store in a jewelry box or pouch to prevent scratches. With proper care, these earrings become a durable staple that only grows with your style.\u003c\/p\u003e \u003cp\u003eElevate your collection with the timeless allure of the Golden Cube Drop Earrings—a geometric touch that enhances everything from everyday essentials to evening-ready looks. Add them to your cart and redefine your go-to accessories with a piece that’s as versatile as it is eye-catching.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610595191,"sku":"SKU_1772743818071_180","price":30.09,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/86a640f6-2409-4ed4-b176-a3aacd5c171f.jpg?v=1774538243"},{"product_id":"rice-artifical-imitation-pearl-white-square-pendant-drop-earrings-18k-golden-plated-simple-design-jewelry-for-women-gift-1pair","title":"Beaded Pearl Cluster Drops","description":"\u003cdiv\u003e\n\u003cp\u003e\u003cstrong\u003eBeaded Pearl Cluster Drops\u003c\/strong\u003e fuse delicate beadwork with a pearl-inspired centerpiece to create earrings that feel both modern and timeless. The carefully arranged cluster catches light from every angle, delivering a soft, elegant glow that enhances everything from a crisp blouse to a formal dress.\u003c\/p\u003e \u003cp\u003ePerfect for weddings, intimate date nights, or elevating your everyday workwear, these earrings add a refined touch without overpowering your outfit. They pair beautifully with everything from a sleek satin dress to a simple cardigan, ensuring you look polished from head to toe.\u003c\/p\u003e \u003cp\u003eThe bead cluster design adds texture and depth, giving your look dimension and movement as you move through the evening. Whether you’re aiming for classic sophistication or a touch of quiet glamour, Beaded Pearl Cluster Drops adapt to your style with effortless grace.\u003c\/p\u003e \u003cul\u003e \u003cli\u003eBeaded cluster delivers texture and light-play for a standout silhouette\u003c\/li\u003e \u003cli\u003ePearl-inspired centerpiece provides enduring, versatile appeal\u003c\/li\u003e \u003cli\u003ePerfect for wedding guests, office-smart outfits, and after-dark looks\u003c\/li\u003e \u003cli\u003eDrop silhouette pairs well with hair up or down for different moods\u003c\/li\u003e \u003cli\u003eEasy to coordinate with necklines ranging from high collars to plunging cuts\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003eCare tips: Wipe with a soft, dry cloth after wearing, and store in a cool, dry place away from cosmetics and moisture to preserve luster. Avoid prolonged exposure to water and harsh chemicals.\u003c\/p\u003e \u003cp\u003eReady to add a touch of understated glamour to your jewelry collection? Add Beaded Pearl Cluster Drops to your cart and enjoy a versatile, go-to pair that elevates every look from day to night.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610529655,"sku":"SKU_1772562794546_507","price":32.68,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/1_baa23110-3e0c-4f0f-9e49-d3547f383328.jpg?v=1774538243"},{"product_id":"elegant-golden-tone-wheat-ear-choker-necklace-with-faux-pearls-vintage-style-perfect-for-casual-attire","title":"Pearl Leaf Link Collar Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eThe Pearl Leaf Link Collar Necklace fuses luminous pearl accents with an organic leaf-link motif, delivering a refined centerpiece that transitions from daytime polish to evening drama with ease.\u003c\/p\u003e \u003ch3\u003eWhy this necklace stands apart\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cb\u003eNature-inspired elegance\u003c\/b\u003e meets classic pearl shine in a design that feels both timeless and contemporary.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eLeaf-link texture\u003c\/b\u003e adds subtle movement and depth, giving a distinctive silhouette that catches the light as you move.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eCollar-length presence\u003c\/b\u003e sits gracefully at the collarbone, creating a bold yet versatile statement without overpowering the neckline.\u003c\/li\u003e \u003cli\u003e\n\u003cb\u003eSolid construction\u003c\/b\u003e with a secure clasp and enduring links designed for everyday wear and special occasions alike.\u003c\/li\u003e\n\u003c\/ul\u003e \u003ch3\u003ePerfect for\u003c\/h3\u003e\n\u003cp\u003eIdeal for those who appreciate jewelry with a natural, elegant edge. This necklace elevates a bridal look without overwhelming it, compliments a sleek office-to-evening transition, and adds a touch of sophistication to a simple blouse or dress. It also makes a thoughtful gift for someone who loves nature-inspired, statement-making accessories.\u003c\/p\u003e \u003ch3\u003eStyling ideas\u003c\/h3\u003e\n\u003cp\u003ePair with a strapless or V-neck gown to let the leaf links frame the neckline, or wear over a crisp white shirt and blazer for a refined, everyday luxury. For a modern twist, layer with a shorter pendant chain, or let it shine solo as a single-focus centerpiece.\u003c\/p\u003e \u003ch3\u003eCare \u0026amp; longevity\u003c\/h3\u003e\n\u003cp\u003eStore in a soft pouch or lined jewelry box when not in use. Wipe with a soft, lint-free cloth after wear to remove oils, and keep away from perfumes, hairspray, and moisture to preserve the pearl luster and metal finish.\u003c\/p\u003e \u003ch3\u003eProduct details\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003eDesign: Pearl accents paired with leaf-inspired links for a natural, elegant look\u003c\/li\u003e \u003cli\u003eSilhouette: Collar-length necklace that rests along the collarbone\u003c\/li\u003e \u003cli\u003eClosure: Secure clasp for reliable wear\u003c\/li\u003e \u003cli\u003eVersatility: Suitable for bridal, formal, and polished casual styles\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610562423,"sku":"SKU_1772743651605_679","price":43.01,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/90228b04-1dc8-4542-b5b9-57710747a3c0.jpg?v=1774538243"},{"product_id":"french-style-elegant-and-sexy-womens-fashion-necklace-irregular-shape-faux-imitation-pearl-unique-design-y-shaped-necklace-for-banquets-parties-festivals-weddings-mothers-day-ramadan","title":"Pearl Cascade Y-Lariat Necklace","description":"\u003cdiv\u003e\n\u003cp\u003eIntroducing the Pearl Cascade Y-Lariat Necklace — a contemporary spin on timeless pearl jewelry that drapes with a soft, organic elegance. The cascade of lustrous pearls traces a graceful Y-shaped line, drawing the eye to the neckline and creating a balanced, elongated silhouette.\u003c\/p\u003e \u003cp\u003eDesigned for versatility, this necklace pairs effortlessly with everything from a crisp blouse to a velvet evening dress. The cascading pearl drop catches light from every angle, adding subtle shimmer without overpowering your look. It's the kind of piece you reach for again and again, whether you're assembling a polished workwear outfit or elevating your after-hours attire.\u003c\/p\u003e \u003ch3\u003eKey features\u003c\/h3\u003e\n\u003cul\u003e \u003cli\u003e\n\u003cstrong\u003eCascade of pearls:\u003c\/strong\u003e A delicate string of pearl beads creates a multi-dimensional pendant that adds texture and depth to any neckline.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eY-lariat silhouette:\u003c\/strong\u003e The Y-shaped drop flatters a variety of necklines, from boat necks to V-necks, for a flattering, modern shine.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eVersatile length:\u003c\/strong\u003e Designed to drape at an optimal point across many body types, enabling a range of styling options.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eEffortless styling:\u003c\/strong\u003e Works with both casual tees and formal dresses, helping you build a capsule jewelry look with a single piece.\u003c\/li\u003e \u003cli\u003e\n\u003cstrong\u003eThoughtful construction:\u003c\/strong\u003e Built with a secure clasp and durable chain that stands up to everyday wear while offering timeless appeal.\u003c\/li\u003e\n\u003c\/ul\u003e \u003cp\u003e\u003cstrong\u003eWho is this for?\u003c\/strong\u003e Ideal for jewelry lovers who crave a piece that blends classic pearls with a contemporary shape. It’s a thoughtful gift for anniversaries, milestone celebrations, or simply to treat someone who appreciates versatile, elegant jewelry.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eCare and wear tips:\u003c\/strong\u003e To keep the pearls lustrous, wipe with a soft cloth after wear and store in a cool, dry place. Avoid sharp pulls or exposure to harsh chemicals. This necklace deserves gentle handling to preserve its sheen over time.\u003c\/p\u003e \u003cp\u003e\u003cstrong\u003eWhy choose the Pearl Cascade Y-Lariat Necklace over other pearl pieces?\u003c\/strong\u003e It merges refined pearl charm with a minimalist, fashion-forward silhouette. The cascading drop provides depth and movement, while the Y-lariat design ensures it sits beautifully on a range of necklines without complicated styling. If you’re shopping for a jewelry piece that transitions effortlessly from office to evening and pairs with multiple outfits, this necklace is a distinctive, everyday-luxury choice.\u003c\/p\u003e\n\u003c\/div\u003e","brand":"Alma Smykker","offers":[{"title":"Default Title","offer_id":56936610627959,"sku":"SKU_1772560691238_500","price":34.4,"currency_code":"EUR","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0919\/2951\/0263\/files\/ed7448a5-8c9e-49d5-a6dc-01815039aff2.jpg?v=1774538243"}],"url":"https:\/\/almasmykker.dk\/pt\/collections\/vandperle.oembed?page=3","provider":"Alma Smykker","version":"1.0","type":"link"}